PDB entry 5gs7

View 5gs7 on RCSB PDB site
Description: Crystal structure determination of Cys2Ala mutant of Bile Salt Hydrolase from Enterococcus feacalis
Class: hydrolase
Keywords: Ntn hydrolase, Cys2Ala mutant, HYDROLASE
Deposited on 2016-08-14, released 2017-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: choloylglycine hydrolase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: ef0040
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KUA7 (0-322)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d5gs7a_
  • Chain 'B':
    Compound: choloylglycine hydrolase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: ef0040
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KUA7 (0-322)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d5gs7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gs7A (A:)
    ataityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyeytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gs7B (B:)
    ataityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
    plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
    lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
    nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
    esisqffhilssveqqkglcdvgdekyeytiyssccnlekgiyyyrtydnsqitavdmnk
    enlekdslivypmvetqqinyan