PDB entry 5gs5

View 5gs5 on RCSB PDB site
Description: Crystal structure of apo rat STING
Class: immune system
Keywords: rat STING, IMMUNE SYSTEM
Deposited on 2016-08-13, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stimulator of interferon genes protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Tmem173, Sting
    Database cross-references and differences (RAF-indexed):
    • Uniprot F1M391 (23-End)
      • expression tag (19-22)
    Domains in SCOPe 2.07: d5gs5a1, d5gs5a2
  • Chain 'B':
    Compound: Stimulator of interferon genes protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Tmem173, Sting
    Database cross-references and differences (RAF-indexed):
    • Uniprot F1M391 (23-220)
      • expression tag (20-22)
      • expression tag (221-224)
    Domains in SCOPe 2.07: d5gs5b1, d5gs5b2, d5gs5b3
  • Chain 'C':
    Compound: Stimulator of interferon genes protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Tmem173, Sting
    Database cross-references and differences (RAF-indexed):
    • Uniprot F1M391 (23-220)
      • expression tag (9-22)
      • expression tag (221-224)
  • Chain 'D':
    Compound: Stimulator of interferon genes protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Tmem173, Sting
    Database cross-references and differences (RAF-indexed):
    • Uniprot F1M391 (23-220)
      • expression tag (10-22)
      • expression tag (221-222)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gs5A (A:)
    mgsshhhhhhssgenlyfqgshmapaevsavceeknfnvahglawsyyigylklilpglq
    arirmfnqlhnnmlsgagsrrlyilfpldcgvpddlsvadpnirfrdmlpqqntdragvk
    nraysnsvyellengqpagacileyatplqtlfamsqdgkagfsredrleqaklfcrtle
    eiladvpesrnhcrlivyqeseegnsfslsqevlrhirqeeaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs5A (A:)
    gshmapaevsavceeknfnvahglawsyyigylklilpglqarirmfnqlhnnmlsgags
    rrlyilfpldcgvpddlsvadpnirfrdmlpqqntdragvknraysnsvyellengqpag
    acileyatplqtlfamsqdgkagfsredrleqaklfcrtleeiladvpesrnhcrlivyq
    eseegnsfslsqevlrhirq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gs5B (B:)
    mgsshhhhhhssgenlyfqgshmapaevsavceeknfnvahglawsyyigylklilpglq
    arirmfnqlhnnmlsgagsrrlyilfpldcgvpddlsvadpnirfrdmlpqqntdragvk
    nraysnsvyellengqpagacileyatplqtlfamsqdgkagfsredrleqaklfcrtle
    eiladvpesrnhcrlivyqeseegnsfslsqevlrhirqeeaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs5B (B:)
    shmapaevsavceeknfnvahglawsyyigylklilpglqarirmfnqlhnnmlsgagsr
    rlyilfpldcgvpddlsvadpnirfrdmlpqqntdragvknraysnsvyellengqpaga
    cileyatplqtlfamsqdgkagfsredrleqaklfcrtleeiladvpesrnhcrlivyqe
    seegnsfslsqevlrhirqeeaaaa
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.