PDB entry 5gs3

View 5gs3 on RCSB PDB site
Description: Crystal structure of diabody
Class: immune system
Keywords: diabody, antibody fragment, IMMUNE SYSTEM
Deposited on 2016-08-13, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diabody protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS3
    Domains in SCOPe 2.07: d5gs3a1, d5gs3a2
  • Chain 'H':
    Compound: diabody protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS3
    Domains in SCOPe 2.07: d5gs3h1, d5gs3h2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gs3A (A:)
    evqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyy
    adsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssg
    gggsdiqmtqspsslsasvgdrvtitcrasqsiglylawyqqkpgkapklliyaasslqs
    gvpsrfsgsgsgtdftltisslqpedfatyycqqgntlsytfgqgtkveiksgrlvprgs
    rshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs3A (A:)
    vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysntyyads
    vkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssdiqm
    tqspsslsasvgdrvtitcrasqsiglylawyqqkpgkapklliyaasslqsgvpsrfsg
    sgsgtdftltisslqpedfatyycqqgntlsytfgqgtkveik
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5gs3H (H:)
    evqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyy
    adsvkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssg
    gggsdiqmtqspsslsasvgdrvtitcrasqsiglylawyqqkpgkapklliyaasslqs
    gvpsrfsgsgsgtdftltisslqpedfatyycqqgntlsytfgqgtkveiksgrlvprgs
    rshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gs3H (H:)
    vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysntyyads
    vkgrftisrdnskntlylqmnsltaedtavyycarfaggwgaydvwgqgtlvtvssdiqm
    tqspsslsasvgdrvtitcrasqsiglylawyqqkpgkapklliyaasslqsgvpsrfsg
    sgsgtdftltisslqpedfatyycqqgntlsytfgqgtkveik