PDB entry 5gs2

View 5gs2 on RCSB PDB site
Description: crystal structure of diabody complex with repebody and mbp
Deposited on 2016-08-13, released 2016-10-12
The last revision was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 3.59 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: malE, b4034, JW3994
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEX9 (0-366)
      • engineered mutation (366)
  • Chain 'B':
    Compound: repebody
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS2
  • Chain 'D':
    Compound: anti-repebody
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS2
  • Chain 'H':
    Compound: anti-MBP
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GS2

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5gs2A (A:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
    lkdaqtn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gs2B (B:)
    etitvstpikqifpddafaetikanlkkksvtdavtqnelnsidqiiannsdiksvqgiq
    ylpnvrylalggnklhdisalkeltnltyliltgnqlqslpngvfdkltnlkelvlvenq
    lqslpdgvfdkltnltylylyhnqlqslpkgvfdkltnltrldldnnqlqslpegvfdkl
    tqlkqlslndnqlksvpdgvfdrltslthiwllnnpwdcacsdilylsrwisqhpglvfg
    ylnldpdsarcsgtntpvravteastspskcpg
    

    Sequence, based on observed residues (ATOM records):
    >5gs2B (B:)
    tvstpikqifpddafaetikanlkkksvtdavtqnelnsidqiiannsdiksvqgiqylp
    nvrylalggnklhdisalkeltnltyliltgnqlqslpngvfdkltnlkelvlvenqlqs
    lpdgvfdkltnltylylyhnqlqslpkgvfdkltnltrldldnnqlqslpegvfdkltql
    kqlslndnqlksvpdgvfdrltslthiwllnnpwdcacsdilylsrwisqhpglvfgyln
    ldpdsarcsgtntpvravteastspskc
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gs2D (D:)
    qvqlkesgpelvkpgasvkmsckasgytftsyvihwvkqrpgqglewigyinpyndgsky
    nekfkgkatltsdkssstaymdlssltsedsavyycarygvrgdyyavdywgqgtsvtvs
    sggggsdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysassl
    ysgvpsrfsgsrsgtdftltisslqpedfatyycqqsssslitfgqgtkveik
    

    Sequence, based on observed residues (ATOM records):
    >5gs2D (D:)
    vqlkesgpelvkpgasvkmsckasgytftsyvihwvkqrpgqglewigyinpyndgskyn
    ekfkgkatltsdkssstaymdlssltsedsavyycarygvrgdyyavdywgqgtsvtvss
    diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
    rfsgsrsgtdftltisslqpedfatyycqqsssslitfgqgtkvei
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5gs2H (H:)
    evqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvasissssgstsy
    adsvkgrftisadtskntaylqmnsltaedtavyycaryghwswgrwwnywvaldywgqg
    tlvtvssggggsdivmtqsqkfmstsagdrvsitckasqnvrtavawyqqkpgqspkali
    ylasnrhtgvpdrftgsgsgtdftltisnvqsedladyfclqhwsypytfgggtkleik
    

    Sequence, based on observed residues (ATOM records):
    >5gs2H (H:)
    vqlvesggglvqpggslrlscaasgfnfssssihwvrqapgkglewvasissssgstsya
    dsvkgrftisadtskntaylqmnsltaedtavyycaryghwswgrwwnywvaldywgqgt
    lvtvssdivmtqsqkfmstsagdrvsitckasqnvrtavawyqqkpgqspkaliylasnr
    htgvpdrftgsgsgtdftltisnvqsedladyfclqhwsypytfgggtkle