PDB entry 5gro

View 5gro on RCSB PDB site
Description: crystal structure of the n-terminal anticodon-binding domain of non- discriminating aspartyl-trna synthetase from helicobacter pylori
Deposited on 2016-08-12, released 2017-02-15
The last revision was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate--tRNA(Asp/Asn) ligase
    Species: Helicobacter pylori 26695 [TaxId:85962]
    Gene: ASPS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Aspartate--tRNA(Asp/Asn) ligase
    Species: Helicobacter pylori 26695 [TaxId:85962]
    Gene: ASPS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, BUA, IMD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5groA (A:)
    mahhhhhhvgtmrshfcteisekdvgkivkvagwcntyrdhggvvfidlrdksglvqlvc
    dpsskayekalevrsefvlvakgkvrlrgaglenpklktgkieivleeliienks
    

    Sequence, based on observed residues (ATOM records):
    >5groA (A:)
    rshfcteisekdvgkivkvagwcntyrdhggvvfidlrdksglvqlvcdpsskayekale
    vrsefvlvakgkvrlrgaglenpklktgkieivleeliienks
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5groB (B:)
    mahhhhhhvgtmrshfcteisekdvgkivkvagwcntyrdhggvvfidlrdksglvqlvc
    dpsskayekalevrsefvlvakgkvrlrgaglenpklktgkieivleeliienks
    

    Sequence, based on observed residues (ATOM records):
    >5groB (B:)
    rshfcteisekdvgkivkvagwcntyrdhggvvfidlrdksglvqlvcdpsskayekale
    vrsefvlvakgkvrlrgaglenpklktgkieivleeliienks