PDB entry 5grj

View 5grj on RCSB PDB site
Description: crystal structure of human pd-l1 with monoclonal antibody avelumab
Deposited on 2016-08-11, released 2016-11-02
The last revision was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 3.21 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death 1 ligand 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PDL1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: avelumab H chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GRJ (0-End)
  • Chain 'L':
    Compound: avelumab L chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GRJ

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5grjA (A:)
    aftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvq
    hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynki
    nqrilvvdpvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstl
    rintttneifyctfrrldpeenhtaelvipelplahppner
    

    Sequence, based on observed residues (ATOM records):
    >5grjA (A:)
    aftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvq
    hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynki
    nqrilvvdpvtseheltcqaegypkaeviwtssdhqvlsgkttttnseklfnvtstlrin
    tttneifyctfrrldpeenhtaelvipelplah
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5grjH (H:)
    evqllesggglvqpggslrlscaasgftfssyimmwvrqapgkglewvssiypsggitfy
    adtvkgrftisrdnskntlylqmnslraedtavyycariklgtvttvdywgqgtlvtvss
    

    Sequence, based on observed residues (ATOM records):
    >5grjH (H:)
    evqllesggglvqpggslrlscaasgftfssyimmwvrqapgkglewvssiypsggitfy
    adtvkgrftisrdnskntlylqmnslraedtavyycariklgtvttvdywgqgtlvtv
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5grjL (L:)
    qsaltqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiydvsnrpsgv
    snrfsgsksgntasltisglqaedeadyycssytssstrvfgtgtkvtvl
    

    Sequence, based on observed residues (ATOM records):
    >5grjL (L:)
    saltqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiydvsnrpsgvs
    nrfsgsksgntasltisglqaedeadyycssytssstrvfgtgtkvtv