PDB entry 5gr3

View 5gr3 on RCSB PDB site
Description: crystal structure of branching enzyme l541a/w655a mutant from cyanothece sp. atcc 51142
Deposited on 2016-08-08, released 2017-08-16
The last revision was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Cyanothece sp. (strain ATCC 51142) [TaxId:43989]
    Gene: glgB, glgB1, cce_2248
    Database cross-references and differences (RAF-indexed):
    • Uniprot B1WPM8
      • engineered mutation (560)
      • engineered mutation (674)
  • Heterogens: GOL, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gr3A (A:)
    mgsshhhhhhssglvprgshmtttisadqvnqiiynlhhdpfeilgchlleegkntkkwv
    vraylpkaeaawvirpterkedpmnsvhhpnffeciietpelnhyqlkvkegehekviyd
    pyafsspyltdediylfsegnhhriyeklgahvgeingvkgvyfavwapnarnvsvigdf
    nnwdgrehqmrkrnytiwelfvpeigsgtvykyeiknseghiyeksdpygfyrevrpnta
    sivvdidniyqwhdeewlekrrnsdplkqpvsvyevhlgswlhgssaekmpllngeadpv
    ivsewnpgarflsyyelaeklipyvkdmgythiellpiaehpfdgswgyqvtgfysptsr
    fgrpedfmyfvdkchengigvildwvpghfpkdshglayfdgthlyehadprigehkewg
    tlvfnygrhevrnflvanvlfwfdkyhvdgirvdavasmlyrnylrkegewianeyggde
    hieavsfirevntllfeyfpgilsiaeestewekvsrpvydgglgfnlkwdmgwmhdmld
    yfnidpyfrqyhqnnvtfsmayyynenfmlalshdeivhgksnmlgkmpgdewqkyanvr
    alftymythpgkktmfmsmefgqwsewnvwgdlewhllqyephqqlkqfftdlnalyqqe
    palythdfeyhgfeaidcndnthsvvsflrrsddpndslvvvcnftpqphshyrigvpea
    gyyvelfnsdakqyggsnmgnlggkwadewsfhnkpysldlclpplavlilkldptkvpe
    gttikeiaadeee
    

    Sequence, based on observed residues (ATOM records):
    >5gr3A (A:)
    isadqvnqiiynlhhdpfeilgchlleegkntkkwvvraylpkaeaawvirpterkedpm
    nsvhhpnffeciietpelnhyqlkvkegehekviydpyafsspyltdediylfsegnhhr
    iyeklgahvgeingvkgvyfavwapnarnvsvigdfnnwdgrehqmrkrnytiwelfvpe
    igsgtvykyeiknseghiyeksdpygfyrevrpntasivvdidniyqwhdeewlekrrns
    dplkqpvsvyevhlgswlhgssaekmpllngeadpvivsewnpgarflsyyelaeklipy
    vkdmgythiellpiaehpfdgswgyqvtgfysptsrfgrpedfmyfvdkchengigvild
    wvpghfpkdshglayfdgthlyehadprigehkewgtlvfnygrhevrnflvanvlfwfd
    kyhvdgirvdavasmlyrnylrkegewianeyggdehieavsfirevntllfeyfpgils
    iaeestewekvsrpvydgglgfnlkwdmgwmhdmldyfnidpyfrqyhqnnvtfsmayyy
    nenfmlalshdeivhgksnmlgkmpgdewqkyanvralftymythpgkktmfmsmefgqw
    sewnvwgdlewhllqyephqqlkqfftdlnalyqqepalythdfeyhgfeaidcndnths
    vvsflrrsddpndslvvvcnftpqphshyrigvpeagyyvelfnsdakqyggsnmgnlgg
    kwadewsfhnkpysldlclpplavlilkldptkvp