PDB entry 5gqv

View 5gqv on RCSB PDB site
Description: crystal structure of branching enzyme from cyanothece sp. atcc 51142 in complex with maltohexaose
Deposited on 2016-08-08, released 2017-02-22
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-alpha-glucan branching enzyme GlgB
    Species: Cyanothece sp. (strain ATCC 51142) [TaxId:43989]
    Gene: glgB, glgB1, cce_2248
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gqvA (A:)
    mgsshhhhhhssglvprgshmtttisadqvnqiiynlhhdpfeilgchlleegkntkkwv
    vraylpkaeaawvirpterkedpmnsvhhpnffeciietpelnhyqlkvkegehekviyd
    pyafsspyltdediylfsegnhhriyeklgahvgeingvkgvyfavwapnarnvsvigdf
    nnwdgrehqmrkrnytiwelfvpeigsgtvykyeiknseghiyeksdpygfyrevrpnta
    sivvdidniyqwhdeewlekrrnsdplkqpvsvyevhlgswlhgssaekmpllngeadpv
    ivsewnpgarflsyyelaeklipyvkdmgythiellpiaehpfdgswgyqvtgfysptsr
    fgrpedfmyfvdkchengigvildwvpghfpkdshglayfdgthlyehadprigehkewg
    tlvfnygrhevrnflvanvlfwfdkyhvdgirvdavasmlyrnylrkegewianeyggde
    hieavsfirevntllfeyfpgilsiaeestewekvsrpvydgglgfnlkwdmgwmhdmld
    yfnidpyfrqyhqnnvtfsmlyyynenfmlalshdeivhgksnmlgkmpgdewqkyanvr
    alftymythpgkktmfmsmefgqwsewnvwgdlewhllqyephqqlkqfftdlnalyqqe
    palythdfeyhgfewidcndnthsvvsflrrsddpndslvvvcnftpqphshyrigvpea
    gyyvelfnsdakqyggsnmgnlggkwadewsfhnkpysldlclpplavlilkldptkvpe
    gttikeiaadeee
    

    Sequence, based on observed residues (ATOM records):
    >5gqvA (A:)
    isadqvnqiiynlhhdpfeilgchlleegkntkkwvvraylpkaeaawvirpterkedpm
    nsvhhpnffeciietpelnhyqlkvkegehekviydpyafsspyltdediylfsegnhhr
    iyeklgahvgeingvkgvyfavwapnarnvsvigdfnnwdgrehqmrkrnytiwelfvpe
    igsgtvykyeiknseghiyeksdpygfyrevrpntasivvdidniyqwhdeewlekrrns
    dplkqpvsvyevhlgswlhgssaekmpllngeadpvivsewnpgarflsyyelaeklipy
    vkdmgythiellpiaehpfdgswgyqvtgfysptsrfgrpedfmyfvdkchengigvild
    wvpghfpkdshglayfdgthlyehadprigehkewgtlvfnygrhevrnflvanvlfwfd
    kyhvdgirvdavasmlyrnylrkegewianeyggdehieavsfirevntllfeyfpgils
    iaeestewekvsrpvydgglgfnlkwdmgwmhdmldyfnidpyfrqyhqnnvtfsmlyyy
    nenfmlalshdeivhgksnmlgkmpgdewqkyanvralftymythpgkktmfmsmefgqw
    sewnvwgdlewhllqyephqqlkqfftdlnalyqqepalythdfeyhgfewidcndnths
    vvsflrrsddpndslvvvcnftpqphshyrigvpeagyyvelfnsdakqyggsnmgnlgg
    kwadewsfhnkpysldlclpplavlilkldptkvp