PDB entry 5gqt

View 5gqt on RCSB PDB site
Description: crystal structure of a specifier protein from arabidopsis thaliana
Deposited on 2016-08-08, released 2017-06-21
The last revision was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile-specifier protein 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NSP1, JAL28, At3g16400, MDC8.2, T02O04.11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SDM9 (Start-469)
      • expression tag (470)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gqtA (A:)
    maqkleakggemgdvwddgvyenvrkvyvgqaqygiafvkfeyvngsqvvvgdehgkkte
    lgveefeidaddyivyvegyrekvndmtsemitflsiktfkgktshpiekrpgvkfvlhg
    gkivgfhgrstdvlhslgayvslsstikllgkwikveqkgegpglrcshgiaqvgnkiys
    fggeftpnqpidkhlyvfdletrtwsispatgdvphlsclgvrmvsvgstlyvfggrdas
    rqyngfysfdtttnewklltpveegptprsfhsmaadeenvyvfggvsatarlntldsyn
    ivdkkwfhcstpgdsltarggaglevvqgkvwvvygfngcevddvhyydpvqdkwtqvet
    fgvrpsersvfasaaigkhivifggeiamdplahvgpgqltdgtfaldtetlqwerldkf
    ggeeetpssrgwtasttatidgkkglvmhggkaptndrfddlffygidsalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gqtA (A:)
    aqkleakggemgdvwddgvyenvrkvyvgqaqygiafvkfeyvngsqvvvgdehgkktel
    gveefeidaddyivyvegyrekvndmtsemitflsiktfkgktshpiekrpgvkfvlhgg
    kivgfhgrstdvlhslgayvslsstikllgkwikveqkgegpglrcshgiaqvgnkiysf
    ggeftpnqpidkhlyvfdletrtwsispatgdvphlsclgvrmvsvgstlyvfggrdasr
    qyngfysfdtttnewklltpveegptprsfhsmaadeenvyvfggvsatarlntldsyni
    vdkkwfhcstpgdsltarggaglevvqgkvwvvygfngcevddvhyydpvqdkwtqvetf
    gvrpsersvfasaaigkhivifggeiamdplahvgpgqltdgtfaldtetlqwerldkfg
    geeetpssrgwtasttatidgkkglvmhggkaptndrfddlffygidsal