PDB entry 5gqm

View 5gqm on RCSB PDB site
Description: crystal structure of in cellulo wild type cypovirus polyhedra
Deposited on 2016-08-07, released 2017-02-15
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyhedrin
    Species: Bombyx mori cypovirus 1 [TaxId:110829]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, MG, GTP, ATP, CTP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5gqmA (A:)
    advagtsnrdfrgreqrlfnseqynynnslngevsvwvyayysdgsvlvinknsqykvgi
    setfkalkeyregqhndsydeyevnqsiyypnggdarkfhsnakpraiqiifspsvnvrt
    ikmakgnavsvpdeylqrshpweatgikyrkikrdgeivgyshyfelpheynsislavsg
    vhknpssynvgsahnvmdvfqscdlalrfcnrywaelelvnhyispnaypyldinnhsyg
    valsnrq