PDB entry 5gqi

View 5gqi on RCSB PDB site
Description: crystal structure of cypovirus polyhedra mutant with deletion of ala194
Deposited on 2016-08-07, released 2017-02-15
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyhedrin
    Species: Bombyx mori cypovirus 1 [TaxId:110829]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11041 (0-245)
      • engineered mutation (191)
  • Heterogens: CL, MG, ATP, CTP, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5gqiA (A:)
    advagtsnrdfrgreqrlfnseqynynnslngevsvwvyayysdgsvlvinknsqykvgi
    setfkalkeyregqhndsydeyevnqsiyypnggdarkfhsnakpraiqiifspsvnvrt
    ikmakgnavsvpdeylqrshpweatgikyrkikrdgeivgyshyfelpheynsislavsg
    vhknpssynvgghnvmdvfqscdlalrfcnrywaelelvnhyispnaypyldinnhsygv
    alsnrq