PDB entry 5gq0

View 5gq0 on RCSB PDB site
Description: crystal structure of the epithiospecifier protein, esp from arabidopsis thaliana
Deposited on 2016-08-05, released 2016-08-17
The last revision was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epithiospecifier protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ESP, ESR, TASTY, At1g54040, F15I1.12
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Epithiospecifier protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ESP, ESR, TASTY, At1g54040, F15I1.12
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gq0A (A:)
    maptlqgqwikvgqkggtgpgprsshgiaavgdklysfggeltpnkhidkdlyvfdfntq
    twsiaqpkgdaptvsclgvrmvavgtkiyifggrdenrnfenfrsydtvtsewtfltkld
    evggpeartfhsmasdenhvyvfggvskggtmntptrfrtieayniadgkwaqlpdpgdn
    fekrggagfavvqgkiwvvygfatsivpggkddyesnavqfydpaskkwtevettgakps
    arsvfahavvgkyiiifagevwpdlnghygpgtlsnegyaldtetlvweklgeegapaip
    rgwtaytaatvdgkngllmhggklptnertddlyfyavnsalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gq0A (A:)
    tlqgqwikvgqkggtgpgprsshgiaavgdklysfggeltpnkhidkdlyvfdfntqtws
    iaqpkgdaptvsclgvrmvavgtkiyifggrdenrnfenfrsydtvtsewtfltkldevg
    gpeartfhsmasdenhvyvfggvskggtmntptrfrtieayniadgkwaqlpdpgdnfek
    rggagfavvqgkiwvvygfatsivpggkddyesnavqfydpaskkwtevettgakpsars
    vfahavvgkyiiifagevwpdlnghygpgtlsnegyaldtetlvweklgeegapaiprgw
    taytaatvdgkngllmhggklptnertddlyfyavnsa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gq0B (B:)
    maptlqgqwikvgqkggtgpgprsshgiaavgdklysfggeltpnkhidkdlyvfdfntq
    twsiaqpkgdaptvsclgvrmvavgtkiyifggrdenrnfenfrsydtvtsewtfltkld
    evggpeartfhsmasdenhvyvfggvskggtmntptrfrtieayniadgkwaqlpdpgdn
    fekrggagfavvqgkiwvvygfatsivpggkddyesnavqfydpaskkwtevettgakps
    arsvfahavvgkyiiifagevwpdlnghygpgtlsnegyaldtetlvweklgeegapaip
    rgwtaytaatvdgkngllmhggklptnertddlyfyavnsalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gq0B (B:)
    tlqgqwikvgqkggtgpgprsshgiaavgdklysfggeltpnkhidkdlyvfdfntqtws
    iaqpkgdaptvsclgvrmvavgtkiyifggrdenrnfenfrsydtvtsewtfltkldevg
    gpeartfhsmasdenhvyvfggvskggtmntptrfrtieayniadgkwaqlpdpgdnfek
    rggagfavvqgkiwvvygfatsddyesnavqfydpaskkwtevettgakpsarsvfahav
    vgkyiiifagevwpdlnghygpgtlsnegyaldtetlvweklgeegapaiprgwtaytaa
    tvdgkngllmhggklptnertddlyfyavn