PDB entry 5gpq

View 5gpq on RCSB PDB site
Description: crystal structure of zebrafish asc card domain
Deposited on 2016-08-04, released 2017-08-09
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose-binding periplasmic protein,Apoptosis-associated speck-like protein containing a CARD
    Species: Danio rerio [TaxId:7955]
    Gene: pycard
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEY0 (1-358)
      • engineered mutation (82-83)
      • engineered mutation (172-173)
      • engineered mutation (239)
      • linker (359-375)
    • Uniprot Q9I9N6 (376-458)
      • expression tag (459-460)
  • Heterogens: CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gpqA (A:)
    mkieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
    ifwahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynk
    dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyaagkydik
    dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsa
    vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
    gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvda
    alaaaqtnaarafaaafidehwkelidrvnnvdpildilrqkkvitnedyctirnketpq
    kkmrelltgpitcagnkgkevlydalresnkflmddledlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gpqA (A:)
    kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
    fwahdrfggyaqsgllaeitpaaafqdklypftwdavryngkliaypiavealsliynkd
    llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyaagkydikd
    vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsav
    nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
    avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
    laaaqtnaarafaaafidehwkelidrvnnvdpildilrqkkvitnedyctirnketpqk
    kmrelltgpitcagnkgkevlydalresnkflmddledle