PDB entry 5gpi

View 5gpi on RCSB PDB site
Description: Crystal Structures of Unlinked NS2B-NS3 Protease from Zika Virus and Its Complex with a Reverse Peptide Inhibitor
Class: viral protein
Keywords: zika virus protease, serine protease, non-structural protein 3, viral protein
Deposited on 2016-08-02, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NS2B cofactor
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GPI
    Domains in SCOPe 2.07: d5gpia_
  • Chain 'B':
    Compound: NS3 protease
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GPI
    Domains in SCOPe 2.07: d5gpib_
  • Chain 'C':
    Compound: NS2B cofactor
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GPI
    Domains in SCOPe 2.07: d5gpic_
  • Chain 'D':
    Compound: NS3 protease
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GPI
    Domains in SCOPe 2.07: d5gpid_
  • Chain 'E':
    Compound: NS2B cofactor
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GPI
    Domains in SCOPe 2.07: d5gpie_
  • Chain 'F':
    Compound: NS3 protease
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GPI
    Domains in SCOPe 2.07: d5gpif_
  • Chain 'G':
    Compound: NS2B cofactor
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GPI
    Domains in SCOPe 2.07: d5gpig_
  • Chain 'H':
    Compound: NS3 protease
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GPI
    Domains in SCOPe 2.07: d5gpih_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gpiA (A:)
    mtgksvdmyieragditwekdaevtgnsprldvaldesgdfslveedgppmre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gpiA (A:)
    dmyieragditwekdaevtgnsprldvaldesgdfslv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gpiB (B:)
    gsgalwdvpapkevkkgettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalr
    sgegrldpywgdvkqdlvsycgpwkldaawdglsevqllavppgerakniqtlpgifktk
    dgdigavaldypagtsgspildkcgrviglygngvvikngsyvsaitqgkreeetpve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gpiB (B:)
    ettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl
    vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg
    spildkcgrviglygngvvikngsyvsaitqgkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gpiC (C:)
    mtgksvdmyieragditwekdaevtgnsprldvaldesgdfslveedgppmre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gpiC (C:)
    myieragditwekdaevtgnsprldvaldesgdfslv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gpiD (D:)
    gsgalwdvpapkevkkgettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalr
    sgegrldpywgdvkqdlvsycgpwkldaawdglsevqllavppgerakniqtlpgifktk
    dgdigavaldypagtsgspildkcgrviglygngvvikngsyvsaitqgkreeetpve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gpiD (D:)
    ttdgvyrvmtstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlvsycgp
    wkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgspildk
    cgrviglygngvvikngsyvsaitqgkr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5gpiE (E:)
    mtgksvdmyieragditwekdaevtgnsprldvaldesgdfslveedgppmre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gpiE (E:)
    dmyieragditwekdaevtgnsprldvaldesgdfslv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5gpiF (F:)
    gsgalwdvpapkevkkgettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalr
    sgegrldpywgdvkqdlvsycgpwkldaawdglsevqllavppgerakniqtlpgifktk
    dgdigavaldypagtsgspildkcgrviglygngvvikngsyvsaitqgkreeetpve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gpiF (F:)
    tdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlvs
    ycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgsp
    ildkcgrviglygngvvikngsyvsaitqgkr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5gpiG (G:)
    mtgksvdmyieragditwekdaevtgnsprldvaldesgdfslveedgppmre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gpiG (G:)
    dmyieragditwekdaevtgnsprldvaldesgdfslvee
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5gpiH (H:)
    gsgalwdvpapkevkkgettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalr
    sgegrldpywgdvkqdlvsycgpwkldaawdglsevqllavppgerakniqtlpgifktk
    dgdigavaldypagtsgspildkcgrviglygngvvikngsyvsaitqgkreeetpve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gpiH (H:)
    evkkgettdgvyrvmttqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlv
    sycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgs
    pildkcgrviglygngvvikngsyvsaitqgkr