PDB entry 5gpg

View 5gpg on RCSB PDB site
Description: Co-crystal structure of the FK506 binding domain of human FKBP25, Rapamycin and the FRB domain of human mTOR
Class: isomerase/transferase
Keywords: complex, kinase, ISOMERASE-TRANSFERASE complex
Deposited on 2016-08-02, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP3
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP3, FKBP25
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00688 (1-116)
      • expression tag (0)
    Domains in SCOPe 2.07: d5gpga1, d5gpga2
  • Chain 'B':
    Compound: Serine/threonine-protein kinase mTOR
    Species: Homo sapiens [TaxId:9606]
    Gene: MTOR, FRAP, FRAP1, FRAP2, RAFT1, RAPT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42345 (1-92)
      • expression tag (0)
    Domains in SCOPe 2.07: d5gpgb1, d5gpgb2
  • Heterogens: RAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gpgA (A:)
    spkytksvlkkgdktnfpkkgdvvhcwytgtlqdgtvfdtniqtsakkkknakplsfkvg
    vgkvirgwdealltmskgekarleiepewaygkkgqpdakippnakltfevelvdid
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gpgA (A:)
    spkytksvlkkgdktnfpkkgdvvhcwytgtlqdgtvfdtniqnakplsfkvgvgkvirg
    wdealltmskgekarleiepewaygkkgqpdakippnakltfevelvdid
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gpgB (B:)
    silwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdlm
    eaqewcrkymksgnvkdltqawdlyyhvfrris