PDB entry 5gpc

View 5gpc on RCSB PDB site
Description: structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
Deposited on 2016-08-01, released 2017-03-01
The last revision was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator (TetR/AcrR family)
    Species: Bacillus halodurans [TaxId:272558]
    Gene: BH3102
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcriptional regulator (TetR/AcrR family)
    Species: Bacillus halodurans [TaxId:272558]
    Gene: BH3102
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Transcriptional regulator (TetR/AcrR family)
    Species: Bacillus halodurans [TaxId:272558]
    Gene: BH3102
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Transcriptional regulator (TetR/AcrR family)
    Species: Bacillus halodurans [TaxId:272558]
    Gene: BH3102
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: DNA (5'-d(p*gp*ap*tp*gp*ap*ap*tp*gp*ap*ap*tp*ap*cp*tp*cp*ap*tp*tp*cp*ap*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'G':
    Compound: DNA (5'-d(p*cp*ap*tp*gp*ap*ap*tp*gp*ap*gp*tp*ap*tp*tp*cp*ap*tp*tp*cp*ap*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gpcA (A:)
    gkkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqe
    kmgrfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkin
    evlkgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalv
    kpvhqlllgglrhr
    

    Sequence, based on observed residues (ATOM records):
    >5gpcA (A:)
    kkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqekm
    grfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkinev
    lkgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkp
    vhqlllgglr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gpcB (B:)
    gkkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqe
    kmgrfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkin
    evlkgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalv
    kpvhqlllgglrhr
    

    Sequence, based on observed residues (ATOM records):
    >5gpcB (B:)
    kgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqekmg
    rfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkinevl
    kgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpv
    hqlllgglrh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gpcC (C:)
    gkkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqe
    kmgrfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkin
    evlkgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalv
    kpvhqlllgglrhr
    

    Sequence, based on observed residues (ATOM records):
    >5gpcC (C:)
    kkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqekm
    grfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkinev
    lkgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkp
    vhqlllgglr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gpcD (D:)
    gkkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqe
    kmgrfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkin
    evlkgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalv
    kpvhqlllgglrhr
    

    Sequence, based on observed residues (ATOM records):
    >5gpcD (D:)
    kgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqekmg
    rfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkinevl
    kgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpv
    hqlllgglrh
    

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    No sequence available.