PDB entry 5gpa

View 5gpa on RCSB PDB site
Description: Structural analysis of fatty acid degradation regulator FadR from Bacillus halodurans
Class: transcription, DNA binding protein
Keywords: fadR, transcriptional regulator, TRANSCRIPTION, DNA BINDING PROTEIN
Deposited on 2016-08-01, released 2017-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator (TetR/AcrR family)
    Species: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) [TaxId:272558]
    Gene: BH3102
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K8A4 (Start-194)
      • engineered mutation (116)
    Domains in SCOPe 2.08: d5gpaa1, d5gpaa2
  • Chain 'B':
    Compound: Transcriptional regulator (TetR/AcrR family)
    Species: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) [TaxId:272558]
    Gene: BH3102
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K8A4
      • engineered mutation (116)
    Domains in SCOPe 2.08: d5gpab1, d5gpab2
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gpaA (A:)
    mgkkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfq
    ekmgrfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelalki
    nevlkgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltal
    vkpvhqlllgglrhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gpaA (A:)
    kkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqek
    mgrfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqleltelalkinevlkg
    ylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpvhq
    lllgglrhr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gpaB (B:)
    mgkkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfq
    ekmgrfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelalki
    nevlkgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltal
    vkpvhqlllgglrhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gpaB (B:)
    kydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqekmgrfv
    dkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelalkinevlkgy
    lnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpvhql
    llgglr