PDB entry 5gp9

View 5gp9 on RCSB PDB site
Description: Structural analysis of fatty acid degradation regulator FadR from Bacillus halodurans
Class: transcription, DNA binding protein
Keywords: fadR, transcriptional regulator, TRANSCRIPTION, DNA BINDING PROTEIN
Deposited on 2016-08-01, released 2017-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator (TetR/AcrR family)
    Species: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) [TaxId:272558]
    Gene: BH3102
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gp9a1, d5gp9a2
  • Chain 'B':
    Compound: Transcriptional regulator (TetR/AcrR family)
    Species: Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) [TaxId:272558]
    Gene: BH3102
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gp9b1, d5gp9b2
  • Heterogens: MG, GOL, PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gp9A (A:)
    gkkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqe
    kmgrfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkin
    evlkgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalv
    kpvhqlllgglrhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gp9A (A:)
    kkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqek
    mgrfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkine
    vlkgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvk
    pvhqlllgglrhr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gp9B (B:)
    gkkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqe
    kmgrfvdkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkin
    evlkgylnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalv
    kpvhqlllgglrhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gp9B (B:)
    kydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqekmgrfv
    dkirsqmneatdveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkinevlkgy
    lnlldellmegkekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpvhql
    llgglrh