PDB entry 5gp4

View 5gp4 on RCSB PDB site
Description: Lactobacillus brevis CGMCC 1306 Glutamate decarboxylase
Class: lyase
Keywords: Glutamate decarboxylase Lactobacillus brevis CGMCC 1306 Gamma-aminobutyric acid pyridoxal phosphate (PLP), LYASE
Deposited on 2016-07-31, released 2017-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate decarboxylase
    Species: LACTOBACILLUS BREVIS [TaxId:1580]
    Gene: GAD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gp4a_
  • Chain 'B':
    Compound: Glutamate decarboxylase
    Species: LACTOBACILLUS BREVIS [TaxId:1580]
    Gene: GAD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gp4b_
  • Chain 'C':
    Compound: Glutamate decarboxylase
    Species: LACTOBACILLUS BREVIS [TaxId:1580]
    Gene: GAD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gp4c_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gp4A (A:)
    mamlygkhthetdetlkpifgasaerhdlpkyklakhalepreadrlvrdqlldegnsrl
    nlatfcqtymepeavelmkdtleknaidkseyprtaeienrcvniianlwhapeaesftg
    tstigsseacmlaglamkfawrkrakangldltahqpnivisagyqvcwekfcvywdidm
    hvvpmdddhmslnvdhvldyvddytigivgimgitytgqyddlarldavverynrttkfp
    vyihvdaasggfytpfiepelkwdfrlnnvisinasghkyglvypgvgwviwrdqqylpk
    elvfkvsylggelptmainfshsasqligqyynfirfgfdgyreiqekthdvarylaksl
    tklggfslindghelplicyeltadsdrewtlydlsdrllmkgwqvptyplpknmtdrvi
    qrivvradfgmsmahdfiddltqaihdldqahivfhsdpqpkkygfth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gp4A (A:)
    etlkpifgasaerhdlpkyklakhalepreadrlvrdqlldegnsrlnlatfcqtymepe
    avelmkdtleknaidkseyprtaeienrcvniianlwhapeaesftgtstigsseacmla
    glamkfawrkrakangldltahqpnivisagyqvcwekfcvywdidmhvvpmdddhmsln
    vdhvldyvddytigivgimgitytgqyddlarldavverynrttkfpvyihvdaasggfy
    tpfiepelkwdfrlnnvisinasghkyglvypgvgwviwrdqqylpkelvfkvsylggel
    ptmainfshsasqligqyynfirfgfdgyreiqekthdvarylaksltklggfslindgh
    elplicyeltadsdrewtlydlsdrllmkgwqvptyplpknmtdrviqrivvradfgmsm
    ahdfiddltqaihdldqahiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gp4B (B:)
    mamlygkhthetdetlkpifgasaerhdlpkyklakhalepreadrlvrdqlldegnsrl
    nlatfcqtymepeavelmkdtleknaidkseyprtaeienrcvniianlwhapeaesftg
    tstigsseacmlaglamkfawrkrakangldltahqpnivisagyqvcwekfcvywdidm
    hvvpmdddhmslnvdhvldyvddytigivgimgitytgqyddlarldavverynrttkfp
    vyihvdaasggfytpfiepelkwdfrlnnvisinasghkyglvypgvgwviwrdqqylpk
    elvfkvsylggelptmainfshsasqligqyynfirfgfdgyreiqekthdvarylaksl
    tklggfslindghelplicyeltadsdrewtlydlsdrllmkgwqvptyplpknmtdrvi
    qrivvradfgmsmahdfiddltqaihdldqahivfhsdpqpkkygfth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gp4B (B:)
    dlpkyklakhalepreadrlvrdqlldegnsrlnlatfcqtymepeavelmkdtleknai
    dkseyprtaeienrcvniianlwhapeaesftgtstigsseacmlaglamkfawrkraka
    ngldltahqpnivisagyqvcwekfcvywdidmhvvpmdddhmslnvdhvldyvddytig
    ivgimgitytgqyddlarldavverynrttkfpvyihvdaasggfytpfiepelkwdfrl
    nnvisinasghkyglvypgvgwviwrdqqylpkelvfkvsylggelptmainfshsasql
    igqyynfirfgfdgyreiqekthdvarylaksltklggfslindghelplicyeltadsd
    rewtlydlsdrllmkgwqvptyplpknmtdrviqrivvradfgmsmahdfiddltqaihd
    ldqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gp4C (C:)
    mamlygkhthetdetlkpifgasaerhdlpkyklakhalepreadrlvrdqlldegnsrl
    nlatfcqtymepeavelmkdtleknaidkseyprtaeienrcvniianlwhapeaesftg
    tstigsseacmlaglamkfawrkrakangldltahqpnivisagyqvcwekfcvywdidm
    hvvpmdddhmslnvdhvldyvddytigivgimgitytgqyddlarldavverynrttkfp
    vyihvdaasggfytpfiepelkwdfrlnnvisinasghkyglvypgvgwviwrdqqylpk
    elvfkvsylggelptmainfshsasqligqyynfirfgfdgyreiqekthdvarylaksl
    tklggfslindghelplicyeltadsdrewtlydlsdrllmkgwqvptyplpknmtdrvi
    qrivvradfgmsmahdfiddltqaihdldqahivfhsdpqpkkygfth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gp4C (C:)
    etlkpifgasaerhdlpkyklakhalepreadrlvrdqlldegnsrlnlatfcqtymepe
    avelmkdtleknaidkseyprtaeienrcvniianlwhapeaesftgtstigsseacmla
    glamkfawrkrakangldltahqpnivisagyqvcwekfcvywdidmhvvpmdddhmsln
    vdhvldyvddytigivgimgitytgqyddlarldavverynrttkfpvyihvdaasggfy
    tpfiepelkwdfrlnnvisinasghkyglvypgvgwviwrdqqylpkelvfkvsylggel
    ptmainfshsasqligqyynfirfgfdgyreiqekthdvarylaksltklggfslindgh
    elplicyeltadsdrewtlydlsdrllmkgwqvptyplpknmtdrviqrivvradfgmsm
    ahdfiddltqaihdldqah