PDB entry 5gow

View 5gow on RCSB PDB site
Description: solution structure of the complex between dp1 acidic region and tfiih p62 ph domain
Deposited on 2016-07-29, released 2016-12-07
The last revision was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dp1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GOW (0-18)
  • Chain 'B':
    Compound: General transcription factor IIH subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2H1, BTF2
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5gowA (A:)
    yvgeddeedddfnendedd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gowB (B:)
    gsmatsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispe
    gkakiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan
    

    Sequence, based on observed residues (ATOM records):
    >5gowB (B:)
    matsseevllivkkvrqkkqdgalylmaeriawapegkdrftishmyadikcqkispegk
    akiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan