PDB entry 5gou

View 5gou on RCSB PDB site
Description: Structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign
Class: oxidoreductase
Keywords: ferritin, 16-mer nanocage, subunit interface redesign, OXIDOREDUCTASE
Deposited on 2016-07-29, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5goua_
  • Chain 'B':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5goub_
  • Chain 'C':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • insertion (144-145)
    Domains in SCOPe 2.07: d5gouc_
  • Chain 'D':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5goud_
  • Chain 'E':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5goue_
  • Chain 'F':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • insertion (139-145)
    Domains in SCOPe 2.07: d5gouf_
  • Chain 'G':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5goug_
  • Chain 'H':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gouh_
  • Chain 'I':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5goui_
  • Chain 'J':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • insertion (145)
    Domains in SCOPe 2.07: d5gouj_
  • Chain 'K':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gouk_
  • Chain 'L':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5goul_
  • Chain 'M':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5goum_
  • Chain 'N':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5goun_
  • Chain 'O':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gouo_
  • Chain 'P':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5goup_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gouA (A:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouA (A:)
    eaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklqnqr
    ggriflqdikkpdcddwesglnamecalhleknvnqsllelhneqvkaikelgdhvtnlr
    kmgapesglaeylfdkhtlgd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gouB (B:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouB (B:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk
    ndphlcdfiet
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gouC (C:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouC (C:)
    qdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklq
    nqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklkaneqvkaikelg
    dhvtnlrkmgapesglaeylfdkhtlgd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gouD (D:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouD (D:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk
    ndphlcdfiet
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5gouE (E:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouE (E:)
    sqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheereh
    aeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdkn
    dphlcdfiethy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5gouF (F:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouF (F:)
    hqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmkl
    qnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhkllneqvkaneqvk
    aikelgdhvtnlrkmgapesglaeylfdkhtl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5gouG (G:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouG (G:)
    astsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqshee
    rehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklat
    dkndphlcdfieth
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5gouH (H:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouH (H:)
    dseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklqn
    qrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklneqvkaikelgdhv
    tnlrkmgapesglaeylfdkhtlgd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5gouI (I:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouI (I:)
    stsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatd
    kndphlcdfieth
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5gouJ (J:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouJ (J:)
    dseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklqn
    qrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklaneqvkaikelgdh
    vtnlrkmgapesglaeylfdkhtlgd
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5gouK (K:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouK (K:)
    stsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheer
    ehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatd
    kndphlcdfieth
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5gouL (L:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouL (L:)
    qdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklq
    nqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklneqvkaikelgdh
    vtnlrkmgapesglaeylfdkhtlgd
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5gouM (M:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouM (M:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk
    ndphlcdfiethy
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5gouN (N:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouN (N:)
    qdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklq
    nqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhkleqvkaikelgdhv
    tnlrkmgapesglaeylfdkhtlg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5gouO (O:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouO (O:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdk
    ndphlcdfiethy
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5gouP (P:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfiethyllneqvkaneqvkaikelgdhvtnlrkmgapesglaeylfdk
    htlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gouP (P:)
    qdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklq
    nqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhkeqvkaikelgdhvt
    nlrkmgapesglaeylfdkhtlg