PDB entry 5gor

View 5gor on RCSB PDB site
Description: crystal structure of alkaline invertase inva from anabaena sp. pcc 7120
Deposited on 2016-07-28, released 2016-11-02
The last revision was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkaline Invertase
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene: invA, alr1521
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Alkaline Invertase
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene: invA, alr1521
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Alkaline Invertase
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene: invA, alr1521
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Alkaline Invertase
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene: invA, alr1521
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Alkaline Invertase
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene: invA, alr1521
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Alkaline Invertase
    Species: Nostoc sp. PCC 7120 [TaxId:103690]
    Gene: invA, alr1521
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gorA (A:)
    mghhhhhhmktppinqkslreteswkllessiiyyegnpigtvaaqdpelaalnydqcfl
    rdfvpsafvflmdgqtdivrnflietltlqshekemdcfqpgaglmpasfkvesdgskey
    lvadfgekaiarvppvdscmwwilllrayekatgdltlarepkfqagiklildlclahrf
    smyptmlvpdgafmidrrmgvyehpleiqvlfyaalraarelllpdgdgeqylnkvhgrl
    galqyhirnyywvdlkrlreiyrykgnefgkeiankfnifsqsipdwviewlpekggyla
    gnlgpgrmdfrffalgnlmailaglaseeesqrimnlfahrwedligympvkicypalqg
    lewqivtgcdpknipwsyhnggnwpvllwlftaaalktgkvelaheaiaiaegrlsndkf
    peyydgnngrligkeariyqtwsiagllvakqflanpdhvefisfpdtfigpgcsl
    

    Sequence, based on observed residues (ATOM records):
    >5gorA (A:)
    lreteswkllessiiyyegnpigtvaaqdpelaalnydqcflrdfvpsafvflmdgqtdi
    vrnflietltlqshekemdcfqpgaglmpasfkvesdgskeylvadfgekaiarvppvds
    cmwwilllrayekatgdltlarepkfqagiklildlclahrfsmyptmlvpdgafmidrr
    mgvyehpleiqvlfyaalraarelllpdgdgeqylnkvhgrlgalqyhirnyywvdlkrl
    reiyrykgnefgkeiankfnifsqsipdwviewlpekggylagnlgpgrmdfrffalgnl
    mailaglaseeesqrimnlfahrwedligympvkicypalqglewqivtgcdpknipwsy
    hnggnwpvllwlftaaalktgkvelaheaiaiaegrlsndkfpeyydgnngrligkeari
    yqtwsiagllvakqflanpdhvefisfpdtfigpgcs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gorB (B:)
    mghhhhhhmktppinqkslreteswkllessiiyyegnpigtvaaqdpelaalnydqcfl
    rdfvpsafvflmdgqtdivrnflietltlqshekemdcfqpgaglmpasfkvesdgskey
    lvadfgekaiarvppvdscmwwilllrayekatgdltlarepkfqagiklildlclahrf
    smyptmlvpdgafmidrrmgvyehpleiqvlfyaalraarelllpdgdgeqylnkvhgrl
    galqyhirnyywvdlkrlreiyrykgnefgkeiankfnifsqsipdwviewlpekggyla
    gnlgpgrmdfrffalgnlmailaglaseeesqrimnlfahrwedligympvkicypalqg
    lewqivtgcdpknipwsyhnggnwpvllwlftaaalktgkvelaheaiaiaegrlsndkf
    peyydgnngrligkeariyqtwsiagllvakqflanpdhvefisfpdtfigpgcsl
    

    Sequence, based on observed residues (ATOM records):
    >5gorB (B:)
    reteswkllessiiyyegnpigtvaaqdpelaalnydqcflrdfvpsafvflmdgqtdiv
    rnflietltlqshekemdcfqpgaglmpasfkvesdgskeylvadfgekaiarvppvdsc
    mwwilllrayekatgdltlarepkfqagiklildlclahrfsmyptmlvpdgafmidrrm
    gvyehpleiqvlfyaalraarelllpdgdgeqylnkvhgrlgalqyhirnyywvdlkrlr
    eiyrykgnefgkeiankfnifsqsipdwviewlpekggylagnlgpgrmdfrffalgnlm
    ailaglaseeesqrimnlfahrwedligympvkicypalqglewqivtgcdpknipwsyh
    nggnwpvllwlftaaalktgkvelaheaiaiaegrlsndkfpeyydgnngrligkeariy
    qtwsiagllvakqflanpdhvefisfpdtfigpgcsl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gorC (C:)
    mghhhhhhmktppinqkslreteswkllessiiyyegnpigtvaaqdpelaalnydqcfl
    rdfvpsafvflmdgqtdivrnflietltlqshekemdcfqpgaglmpasfkvesdgskey
    lvadfgekaiarvppvdscmwwilllrayekatgdltlarepkfqagiklildlclahrf
    smyptmlvpdgafmidrrmgvyehpleiqvlfyaalraarelllpdgdgeqylnkvhgrl
    galqyhirnyywvdlkrlreiyrykgnefgkeiankfnifsqsipdwviewlpekggyla
    gnlgpgrmdfrffalgnlmailaglaseeesqrimnlfahrwedligympvkicypalqg
    lewqivtgcdpknipwsyhnggnwpvllwlftaaalktgkvelaheaiaiaegrlsndkf
    peyydgnngrligkeariyqtwsiagllvakqflanpdhvefisfpdtfigpgcsl
    

    Sequence, based on observed residues (ATOM records):
    >5gorC (C:)
    reteswkllessiiyyegnpigtvaaqdpelaalnydqcflrdfvpsafvflmdgqtdiv
    rnflietltlqshekemdcfqpgaglmpasfkvesdgskeylvadfgekaiarvppvdsc
    mwwilllrayekatgdltlarepkfqagiklildlclahrfsmyptmlvpdgafmidrrm
    gvyehpleiqvlfyaalraarelllpdgdgeqylnkvhgrlgalqyhirnyywvdlkrlr
    eiyrykgnefgkeiankfnifsqsipdwviewlpekggylagnlgpgrmdfrffalgnlm
    ailaglaseeesqrimnlfahrwedligympvkicypalqglewqivtgcdpknipwsyh
    nggnwpvllwlftaaalktgkvelaheaiaiaegrlsndkfpeyydgnngrligkeariy
    qtwsiagllvakqflanpdhvefisfpdtfigpgcsl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gorD (D:)
    mghhhhhhmktppinqkslreteswkllessiiyyegnpigtvaaqdpelaalnydqcfl
    rdfvpsafvflmdgqtdivrnflietltlqshekemdcfqpgaglmpasfkvesdgskey
    lvadfgekaiarvppvdscmwwilllrayekatgdltlarepkfqagiklildlclahrf
    smyptmlvpdgafmidrrmgvyehpleiqvlfyaalraarelllpdgdgeqylnkvhgrl
    galqyhirnyywvdlkrlreiyrykgnefgkeiankfnifsqsipdwviewlpekggyla
    gnlgpgrmdfrffalgnlmailaglaseeesqrimnlfahrwedligympvkicypalqg
    lewqivtgcdpknipwsyhnggnwpvllwlftaaalktgkvelaheaiaiaegrlsndkf
    peyydgnngrligkeariyqtwsiagllvakqflanpdhvefisfpdtfigpgcsl
    

    Sequence, based on observed residues (ATOM records):
    >5gorD (D:)
    reteswkllessiiyyegnpigtvaaqdpelaalnydqcflrdfvpsafvflmdgqtdiv
    rnflietltlqshekemdcfqpgaglmpasfkvesdgskeylvadfgekaiarvppvdsc
    mwwilllrayekatgdltlarepkfqagiklildlclahrfsmyptmlvpdgafmidrrm
    gvyehpleiqvlfyaalraarelllpdgdgeqylnkvhgrlgalqyhirnyywvdlkrlr
    eiyrykgnefgkeiankfnifsqsipdwviewlpekggylagnlgpgrmdfrffalgnlm
    ailaglaseeesqrimnlfahrwedligympvkicypalqglewqivtgcdpknipwsyh
    nggnwpvllwlftaaalktgkvelaheaiaiaegrlsndkfpeyydgnngrligkeariy
    qtwsiagllvakqflanpdhvefisfpdtfigpgc
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5gorE (E:)
    mghhhhhhmktppinqkslreteswkllessiiyyegnpigtvaaqdpelaalnydqcfl
    rdfvpsafvflmdgqtdivrnflietltlqshekemdcfqpgaglmpasfkvesdgskey
    lvadfgekaiarvppvdscmwwilllrayekatgdltlarepkfqagiklildlclahrf
    smyptmlvpdgafmidrrmgvyehpleiqvlfyaalraarelllpdgdgeqylnkvhgrl
    galqyhirnyywvdlkrlreiyrykgnefgkeiankfnifsqsipdwviewlpekggyla
    gnlgpgrmdfrffalgnlmailaglaseeesqrimnlfahrwedligympvkicypalqg
    lewqivtgcdpknipwsyhnggnwpvllwlftaaalktgkvelaheaiaiaegrlsndkf
    peyydgnngrligkeariyqtwsiagllvakqflanpdhvefisfpdtfigpgcsl
    

    Sequence, based on observed residues (ATOM records):
    >5gorE (E:)
    reteswkllessiiyyegnpigtvaaqdpelaalnydqcflrdfvpsafvflmdgqtdiv
    rnflietltlqshekemdcfqpgaglmpasfkvesdgskeylvadfgekaiarvppvdsc
    mwwilllrayekatgdltlarepkfqagiklildlclahrfsmyptmlvpdgafmidrrm
    gvyehpleiqvlfyaalraarelllpdgdgeqylnkvhgrlgalqyhirnyywvdlkrlr
    eiyrykgnefgkeiankfnifsqsipdwviewlpekggylagnlgpgrmdfrffalgnlm
    ailaglaseeesqrimnlfahrwedligympvkicypalqglewqivtgcdpknipwsyh
    nggnwpvllwlftaaalktgkvelaheaiaiaegrlsndkfpeyydgnngrligkeariy
    qtwsiagllvakqflanpdhvefisfpdtfigpgcsl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5gorF (F:)
    mghhhhhhmktppinqkslreteswkllessiiyyegnpigtvaaqdpelaalnydqcfl
    rdfvpsafvflmdgqtdivrnflietltlqshekemdcfqpgaglmpasfkvesdgskey
    lvadfgekaiarvppvdscmwwilllrayekatgdltlarepkfqagiklildlclahrf
    smyptmlvpdgafmidrrmgvyehpleiqvlfyaalraarelllpdgdgeqylnkvhgrl
    galqyhirnyywvdlkrlreiyrykgnefgkeiankfnifsqsipdwviewlpekggyla
    gnlgpgrmdfrffalgnlmailaglaseeesqrimnlfahrwedligympvkicypalqg
    lewqivtgcdpknipwsyhnggnwpvllwlftaaalktgkvelaheaiaiaegrlsndkf
    peyydgnngrligkeariyqtwsiagllvakqflanpdhvefisfpdtfigpgcsl
    

    Sequence, based on observed residues (ATOM records):
    >5gorF (F:)
    reteswkllessiiyyegnpigtvaaqdpelaalnydqcflrdfvpsafvflmdgqtdiv
    rnflietltlqshekemdcfqpgaglmpasfkvesdgskeylvadfgekaiarvppvdsc
    mwwilllrayekatgdltlarepkfqagiklildlclahrfsmyptmlvpdgafmidrrm
    gvyehpleiqvlfyaalraarelllpdgdgeqylnkvhgrlgalqyhirnyywvdlkrlr
    eiyrykgnefgkeiankfnifsqsipdwviewlpekggylagnlgpgrmdfrffalgnlm
    ailaglaseeesqrimnlfahrwedligympvkicypalqglewqivtgcdpknipwsyh
    nggnwpvllwlftaaalktgkvelaheaiaiaegrlsndkfpeyydgnngrligkeariy
    qtwsiagllvakqflanpdhvefisfpdtfigpgcsl