PDB entry 5gom

View 5gom on RCSB PDB site
Description: truncated mitofusin-1, transition-like state
Deposited on 2016-07-27, released 2017-02-01
The last revision was dated 2017-03-08, with a file datestamp of 2017-03-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitofusin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: MFN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IWA4 (Start-368)
      • linker (369-375)
    • Uniprot Q8IWA4 (376-End)
  • Chain 'B':
    Compound: Mitofusin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: MFN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IWA4 (Start-368)
      • linker (369-375)
    • Uniprot Q8IWA4 (376-End)
  • Heterogens: GDP, DTT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gomA (A:)
    gphmggsmaepvsplkhfvlakkaitaifdqllefvtegshfveatyknpeldriatedd
    lvemqgykdklsiigevlsrrhmkvaffgrtssgkssvinamlwdkvlpsgighitncfl
    svegtdgdkaylmtegsdekksvktvnqlahalhmdkdlkagclvrvfwpkakcallrdd
    lvlvdspgtdvtteldswidkfcldadvfvlvansestlmntekhffhkvnerlskpnif
    ilnnrwdasasepeymedvrrqhmerclhflveelkvvnaleaqnriffvsakevlsark
    qkaqgmpesgvalaegfharlqefqnfeqifeecisqsavktkfeqhtirakqilatvkn
    imdsvnlaaedkrhysarlpkeidqlekiqnnskllrnkavqlenelenftkqflpssne
    es
    

    Sequence, based on observed residues (ATOM records):
    >5gomA (A:)
    epvsplkhfvlakkaitaifdqllefvtegshfveatyknpeldriateddlvemqgykd
    klsiigevlsrrhmkvaffgrtssgkssvinamlwdkvlpsgighitncflsvegtdgdk
    aylmtegsdekksvktvnqlahalhmdkdlkagclvrvfwpkakcallrddlvlvdspgt
    dvtteldswidkfcldadvfvlvansestlmntekhffhkvnerlskpnifilnnrwdas
    asepeymedvrrqhmerclhflveelkvvnaleaqnriffvsakevlsarkqkaqgmpes
    gvalaegfharlqefqnfeqifeecisqsavktkfeqhtirakqilatvknimdsvnlaa
    edkrhysarlpkeidqlekiqnnskllrnkavqlenelenftkqflp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gomB (B:)
    gphmggsmaepvsplkhfvlakkaitaifdqllefvtegshfveatyknpeldriatedd
    lvemqgykdklsiigevlsrrhmkvaffgrtssgkssvinamlwdkvlpsgighitncfl
    svegtdgdkaylmtegsdekksvktvnqlahalhmdkdlkagclvrvfwpkakcallrdd
    lvlvdspgtdvtteldswidkfcldadvfvlvansestlmntekhffhkvnerlskpnif
    ilnnrwdasasepeymedvrrqhmerclhflveelkvvnaleaqnriffvsakevlsark
    qkaqgmpesgvalaegfharlqefqnfeqifeecisqsavktkfeqhtirakqilatvkn
    imdsvnlaaedkrhysarlpkeidqlekiqnnskllrnkavqlenelenftkqflpssne
    es
    

    Sequence, based on observed residues (ATOM records):
    >5gomB (B:)
    vsplkhfvlakkaitaifdqllefvtegshfveatyknpeldriateddlvemqgykdkl
    siigevlsrrhmkvaffgrtssgkssvinamlwdkvlpsgighitncflsvegtdgdkay
    lmtegsdekksvktvnqlahalhmdkdlkagclvrvfwpkakcallrddlvlvdspgtdt
    eldswidkfcldadvfvlvansestlmntekhffhkvnerlskpnifilnnrwdasasep
    eymedvrrqhmerclhflveelkvvnaleaqnriffvsakevlsarkqkaqgmpesgval
    aegfharlqefqnfeqifeecisqsavktkfeqhtirakqilatvknimdsvnlaaedkr
    hysarlpkeidqlekiqnnskllrnkavqlenelenftkqflps