PDB entry 5gof

View 5gof on RCSB PDB site
Description: truncated mitofusin-1, gtp-bound
Deposited on 2016-07-26, released 2017-01-25
The last revision was dated 2017-03-08, with a file datestamp of 2017-03-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitofusin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: MFN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IWA4 (Start-368)
      • linker (369-375)
    • Uniprot Q8IWA4 (376-End)
  • Heterogens: GTP, MG, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gofA (A:)
    gphmggsmaepvsplkhfvlakkaitaifdqllefvtegshfveatyknpeldriatedd
    lvemqgykdklsiigevlsrrhmkvaffgrtssgkssvinamlwdkvlpsgighitncfl
    svegtdgdkaylmtegsdekksvktvnqlahalhmdkdlkagclvrvfwpkakcallrdd
    lvlvdspgtdvtteldswidkfcldadvfvlvansestlmntekhffhkvnerlskpnif
    ilnnrwdasasepeymedvrrqhmerclhflveelkvvnaleaqnriffvsakevlsark
    qkaqgmpesgvalaegfharlqefqnfeqifeecisqsavktkfeqhtirakqilatvkn
    imdsvnlaaedkrhysarlpkeidqlekiqnnskllrnkavqlenelenftkqflpssne
    es
    

    Sequence, based on observed residues (ATOM records):
    >5gofA (A:)
    pvsplkhfvlakkaitaifdqllefvtegshfveatyknpeldriateddlvemqgykdk
    lsiigevlsrrhmkvaffgrtssgkssvinamlwdkvlpsgighitncflsvegtdgdka
    ylmtegsdekksvktvnqlahalhagclvrvfwpkakcallrddlvlvdspgtdeldswi
    dkfcldadvfvlvansestlmntekhffhkvnerlskpnifilnnrwdasasepeymedv
    rrqhmerclhflveelkvvnaleaqnriffvsakevlsarkqkvalaegfharlqefqnf
    eqifeecisqsavktkfeqhtirakqilatvknimdsvnlaaedkrhysarlpkeidqle
    kiqnnskllrnkavqlenelenftkqflps