PDB entry 5go2

View 5go2 on RCSB PDB site
Description: Crystal structure of chorismate mutase like domain of bifunctional DAHP synthase of Bacillus subtilis in complex with Citrate
Class: isomerase
Keywords: Type II chorismate mutase, CML domain, Bifunctional DAHP synthase, citrate, bacillus subtilis, ISOMERASE
Deposited on 2016-07-26, released 2017-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein AroA(G)
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: aroA, BSU29750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5go2a_
  • Chain 'B':
    Compound: Protein AroA(G)
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: aroA, BSU29750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5go2b_
  • Chain 'C':
    Compound: Protein AroA(G)
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: aroA, BSU29750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5go2c_
  • Chain 'D':
    Compound: Protein AroA(G)
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: aroA, BSU29750
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5go2d_
  • Heterogens: SO4, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5go2A (A:)
    msntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniie
    nndgpfenstiqhifkeifkaglelqeedh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5go2A (A:)
    msntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniie
    nndgpfenstiqhifkeifkaglelq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5go2B (B:)
    msntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniie
    nndgpfenstiqhifkeifkaglelqeedh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5go2B (B:)
    msntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniie
    nndgpfenstiqhifkeifkaglelqee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5go2C (C:)
    msntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniie
    nndgpfenstiqhifkeifkaglelqeedh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5go2C (C:)
    sntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniien
    ndgpfenstiqhifkeifkaglelqee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5go2D (D:)
    msntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniie
    nndgpfenstiqhifkeifkaglelqeedh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5go2D (D:)
    msntelellrqkadelnlqilklinergnvvkeigkakeaqgvnrfdpvrertmlnniie
    nndgpfenstiqhifkeifkaglelqe