PDB entry 5go1

View 5go1 on RCSB PDB site
Description: Structural, Functional characterization and discovery of novel inhibitors of Leishmania amazonensis Nucleoside Diphosphatase Kinase (NDK)
Class: transferase
Keywords: Kinase, Leishmania amazonensis, inhibitor, TRANSFERASE
Deposited on 2016-07-26, released 2017-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Leishmania amazonensis [TaxId:5659]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GO1
    Domains in SCOPe 2.08: d5go1a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5go1A (A:)
mssertfiavkpdgvqrglagevicrferkgyklvalkmlqptteqaeghykdlsskpff
palvkyfssgpivcmvwegknvvkggrmllgatnpadshpgtirgdfavdmgrnvchgsd
svesaereiafwfkadelacwtshsvsqiye

    Sequence, based on observed residues (ATOM records): (download) 
    >5go1A (A:)
sertfiavkpdgvqrglagevicrferkgyklvalkmlqpsgpivcmvwegknvvkggrm
llgatnpadshpgtirgdfavdmgrnvchgsdsvesaereiafwfkadelac