PDB entry 5gny

View 5gny on RCSB PDB site
Description: the structure of wt bgl6
Deposited on 2016-07-25, released 2017-04-12
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: metagenome [TaxId:256318]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GNY
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: metagenome [TaxId:256318]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GNY
  • Chain 'C':
    Compound: Beta-glucosidase
    Species: metagenome [TaxId:256318]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GNY
  • Chain 'D':
    Compound: Beta-glucosidase
    Species: metagenome [TaxId:256318]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GNY
  • Heterogens: BGC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gnyA (A:)
    mgsmtsdtarsyrfpegflwgaataayqiegssmadgagesiwdrfshtpgnmkdgdtgd
    vacdhynrwredielmkrlnlqayrfsvswsrvipqgrgainpkglafydrlvdglleag
    ieplatlyhwdlpaalddrggwlnpdiadwfadygqvlfekfkgrvktwgtinepwvivd
    ggylhgalapghrsayeaviaghnvlrahgaavrrfrevgegqigivlniepkypasdkp
    edeaarrraeaqmnrwfldplmgrgypeeltdvygaawrefpkedfeliaeptdwmglnw
    ytravpenapdawptrsrpvrqtqhahtetgwevyppaltdtlvwlseqtggklplmvte
    ngsawydpphaidgrihdpmrvhylqthikalhdaigkgvdlrgymawslldnlewslgy
    skrfgivhvnfatqertikdsgllyaevikthgdvlntlklhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gnyA (A:)
    syrfpegflwgaataayqiegssmadgagesiwdrfshtpgnmkdgdtgdvacdhynrwr
    edielmkrlnlqayrfsvswsrvipqgrgainpkglafydrlvdglleagieplatlyhw
    dlpaalddrggwlnpdiadwfadygqvlfekfkgrvktwgtinepwvivdggylhgalap
    ghrsayeaviaghnvlrahgaavrrfrevgegqigivlniepkypasdkpedeaarrrae
    aqmnrwfldplmgrgypeeltdvygaawrefpkedfeliaeptdwmglnwytravpenap
    dawptrsrpvrqtqhahtetgwevyppaltdtlvwlseqtggklplmvtengsawydpph
    aidgrihdpmrvhylqthikalhdaigkgvdlrgymawslldnlewslgyskrfgivhvn
    fatqertikdsgllyaevikthgdvlnt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gnyB (B:)
    mgsmtsdtarsyrfpegflwgaataayqiegssmadgagesiwdrfshtpgnmkdgdtgd
    vacdhynrwredielmkrlnlqayrfsvswsrvipqgrgainpkglafydrlvdglleag
    ieplatlyhwdlpaalddrggwlnpdiadwfadygqvlfekfkgrvktwgtinepwvivd
    ggylhgalapghrsayeaviaghnvlrahgaavrrfrevgegqigivlniepkypasdkp
    edeaarrraeaqmnrwfldplmgrgypeeltdvygaawrefpkedfeliaeptdwmglnw
    ytravpenapdawptrsrpvrqtqhahtetgwevyppaltdtlvwlseqtggklplmvte
    ngsawydpphaidgrihdpmrvhylqthikalhdaigkgvdlrgymawslldnlewslgy
    skrfgivhvnfatqertikdsgllyaevikthgdvlntlklhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gnyB (B:)
    rsyrfpegflwgaataayqiegssmadgagesiwdrfshtpgnmkdgdtgdvacdhynrw
    redielmkrlnlqayrfsvswsrvipqgrgainpkglafydrlvdglleagieplatlyh
    wdlpaalddrggwlnpdiadwfadygqvlfekfkgrvktwgtinepwvivdggylhgala
    pghrsayeaviaghnvlrahgaavrrfrevgegqigivlniepkypasdkpedeaarrra
    eaqmnrwfldplmgrgypeeltdvygaawrefpkedfeliaeptdwmglnwytravpena
    pdawptrsrpvrqtqhahtetgwevyppaltdtlvwlseqtggklplmvtengsawydpp
    haidgrihdpmrvhylqthikalhdaigkgvdlrgymawslldnlewslgyskrfgivhv
    nfatqertikdsgllyaevikthgdvln
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gnyC (C:)
    mgsmtsdtarsyrfpegflwgaataayqiegssmadgagesiwdrfshtpgnmkdgdtgd
    vacdhynrwredielmkrlnlqayrfsvswsrvipqgrgainpkglafydrlvdglleag
    ieplatlyhwdlpaalddrggwlnpdiadwfadygqvlfekfkgrvktwgtinepwvivd
    ggylhgalapghrsayeaviaghnvlrahgaavrrfrevgegqigivlniepkypasdkp
    edeaarrraeaqmnrwfldplmgrgypeeltdvygaawrefpkedfeliaeptdwmglnw
    ytravpenapdawptrsrpvrqtqhahtetgwevyppaltdtlvwlseqtggklplmvte
    ngsawydpphaidgrihdpmrvhylqthikalhdaigkgvdlrgymawslldnlewslgy
    skrfgivhvnfatqertikdsgllyaevikthgdvlntlklhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gnyC (C:)
    rsyrfpegflwgaataayqiegssmadgagesiwdrfshtpgnmkdgdtgdvacdhynrw
    redielmkrlnlqayrfsvswsrvipqgrgainpkglafydrlvdglleagieplatlyh
    wdlpaalddrggwlnpdiadwfadygqvlfekfkgrvktwgtinepwvivdggylhgala
    pghrsayeaviaghnvlrahgaavrrfrevgegqigivlniepkypasdkpedeaarrra
    eaqmnrwfldplmgrgypeeltdvygaawrefpkedfeliaeptdwmglnwytravpena
    pdawptrsrpvrqtqhahtetgwevyppaltdtlvwlseqtggklplmvtengsawydpp
    haidgrihdpmrvhylqthikalhdaigkgvdlrgymawslldnlewslgyskrfgivhv
    nfatqertikdsgllyaevikthgdvln
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gnyD (D:)
    mgsmtsdtarsyrfpegflwgaataayqiegssmadgagesiwdrfshtpgnmkdgdtgd
    vacdhynrwredielmkrlnlqayrfsvswsrvipqgrgainpkglafydrlvdglleag
    ieplatlyhwdlpaalddrggwlnpdiadwfadygqvlfekfkgrvktwgtinepwvivd
    ggylhgalapghrsayeaviaghnvlrahgaavrrfrevgegqigivlniepkypasdkp
    edeaarrraeaqmnrwfldplmgrgypeeltdvygaawrefpkedfeliaeptdwmglnw
    ytravpenapdawptrsrpvrqtqhahtetgwevyppaltdtlvwlseqtggklplmvte
    ngsawydpphaidgrihdpmrvhylqthikalhdaigkgvdlrgymawslldnlewslgy
    skrfgivhvnfatqertikdsgllyaevikthgdvlntlklhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gnyD (D:)
    rsyrfpegflwgaataayqiegssmadgagesiwdrfshtpgnmkdgdtgdvacdhynrw
    redielmkrlnlqayrfsvswsrvipqgrgainpkglafydrlvdglleagieplatlyh
    wdlpaalddrggwlnpdiadwfadygqvlfekfkgrvktwgtinepwvivdggylhgala
    pghrsayeaviaghnvlrahgaavrrfrevgegqigivlniepkypasdkpedeaarrra
    eaqmnrwfldplmgrgypeeltdvygaawrefpkedfeliaeptdwmglnwytravpena
    pdawptrsrpvrqtqhahtetgwevyppaltdtlvwlseqtggklplmvtengsawydpp
    haidgrihdpmrvhylqthikalhdaigkgvdlrgymawslldnlewslgyskrfgivhv
    nfatqertikdsgllyaevikthgdvln