PDB entry 5gnr

View 5gnr on RCSB PDB site
Description: the structure of mini-mfn1 k88a in complex with gdp
Deposited on 2016-07-24, released 2016-11-23
The last revision was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitofusin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: MFN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IWA4 (Start-363)
      • engineered mutation (87)
      • expression tag (364-366)
      • expression tag (377-415)
  • Heterogens: GDP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gnrA (A:)
    maepvsplkhfvlakkaitaifdqllefvtegshfveatyknpeldriateddlvemqgy
    kdklsiigevlsrrhmkvaffgrtssgassvinamlwdkvlpsgighitncflsvegtdg
    dkaylmtegsdekksvktvnqlahalhmdkdlkagclvrvfwpkakcallrddlvlvdsp
    gtdvtteldswidkfcldadvfvlvansestlmntekhffhkvnerlskpnifilnnrwd
    asasepeymedvrrqhmerclhflveelkvvnaleaqnriffvsakevlsarkqkaqgmp
    esgvalaegfharlqefqnfeqifeecisqsavktkfeqhtirakqilatvknimdsvnl
    aaedgsgsgsggseiarlpkeidqlekiqnnskllrnkavqlenelenftkqflpssnee
    s
    

    Sequence, based on observed residues (ATOM records):
    >5gnrA (A:)
    pvsplkhfvlakkaitaifdqllefvtegshfveatyknpeldriateddlvemqgykdk
    lsiigevlsrrhmkvaffgrtssgassvinamlwdkvlpsgighitncflsvegtdgdka
    ylmtegsdekksvktvnqlaagclvrvfwpkakcallrddlvlvdspgtdeldswidkfc
    ldadvfvlvansestlmntekhffhkvnerlskpnifilnnrwdasasepeymedvrrqh
    merclhflveelkvvnaleaqnriffvsakevlsarkqkaqgsgvalaegfharlqefqn
    feqifeecisqsavktkfeqhtirakqilatvknimdsvnlaaedgsglpkeidqlekiq
    nnskllrnkavqlenelenftkqflps