PDB entry 5gnq

View 5gnq on RCSB PDB site
Description: crystal structure of replisomal dimer of dna polymerase from bacteriophage rb69 with dna duplexes
Deposited on 2016-07-24, released 2017-07-26
The last revision was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: 43
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38087 (5-End)
      • expression tag (3-4)
      • engineered mutation (226)
      • engineered mutation (331)
  • Chain 'B':
    Compound: DNA polymerase
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: 43
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38087 (5-End)
      • engineered mutation (226)
      • engineered mutation (331)
  • Chain 'P':
    Compound: DNA (5'-d(*gp*ap*gp*cp*gp*gp*ap*cp*tp*gp*cp*tp*tp*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'Q':
    Compound: DNA (5'-d(*gp*ap*gp*cp*gp*gp*ap*cp*tp*gp*cp*tp*tp*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'S':
    Compound: DNA (5'-d(*tp*cp*ap*ap*gp*tp*ap*ap*gp*cp*ap*gp*tp*cp*cp*gp*cp*tp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'T':
    Compound: DNA (5'-d(*tp*cp*ap*ap*gp*tp*ap*ap*gp*cp*ap*gp*tp*cp*cp*gp*cp*tp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: DUP, CA, 5GP, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gnqA (A:)
    gamgsmkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygk
    pctrklfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdi
    evtspdgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqgg
    devpseiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifg
    estakrlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyise
    felnvgklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqi
    qsvfspiktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltsl
    ypsiirqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvptei
    tkvfnqrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsa
    kslnemlfraqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalq
    wierkvneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfa
    rermepaidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdm
    egtryaepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqln
    yisiasvssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlpl
    regnpfgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekka
    slfdmfdf
    

    Sequence, based on observed residues (ATOM records):
    >5gnqA (A:)
    gsmkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpct
    rklfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievt
    spdgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdev
    pseiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgest
    akrlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefel
    nvgklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsv
    fspiktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslyps
    iirqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkv
    fnqrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsaksl
    nemlfraqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwie
    rkvneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarer
    mepaidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegt
    ryaepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyis
    iasvssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplreg
    npfgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkasl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gnqB (B:)
    gamgsmkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygk
    pctrklfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdi
    evtspdgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqgg
    devpseiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifg
    estakrlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyise
    felnvgklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqi
    qsvfspiktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltsl
    ypsiirqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvptei
    tkvfnqrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsa
    kslnemlfraqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalq
    wierkvneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfa
    rermepaidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdm
    egtryaepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqln
    yisiasvssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlpl
    regnpfgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekka
    slfdmfdf
    

    Sequence, based on observed residues (ATOM records):
    >5gnqB (B:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslne
    mlfraqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwierk
    vneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarerme
    paidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtry
    aepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisia
    svssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnp
    fgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdm
    f
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.