PDB entry 5gnk

View 5gnk on RCSB PDB site
Description: Crystal structure of EGFR 696-988 T790M in complex with LXX-6-34
Class: transferase
Keywords: EGFR, T790M, LXX-6-34, inhibitor, TRANSFERASE
Deposited on 2016-07-21, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5gnka_
  • Heterogens: 80U, NO3, EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gnkA (A:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gnkA (A:)
    eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
    keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
    wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgvpikwmalesilh
    riythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimv
    kcwmidadsrpkfreliiefskmardpqrylviqgde