PDB entry 5gnh

View 5gnh on RCSB PDB site
Description: Myotubularin-related protein 2
Class: hydrolase
Keywords: MTMR2, PI, Myotubularin-related protein, HYDROLASE
Deposited on 2016-07-21, released 2017-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myotubularin-related protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MTMR2, KIAA1073
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13614
      • engineered mutation (344)
    Domains in SCOPe 2.07: d5gnha1, d5gnha2
  • Chain 'B':
    Compound: Myotubularin-related protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MTMR2, KIAA1073
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13614
      • engineered mutation (344)
    Domains in SCOPe 2.07: d5gnhb1, d5gnhb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gnhA (A:)
    meeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvi
    nrvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlpl
    fafeykevfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipd
    eelkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaq
    shkififdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivyp
    nieethwlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslam
    lmldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtr
    qfptafefneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledft
    nplygsysnhvlypvasmrhlelwvgyyirwnprmkpqepihnrykellakraelqkkve
    elqreisnrstssserasspaqcvtpvqtvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gnhA (A:)
    eppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvinr
    vekigensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplfafeykev
    fpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipdeelkrvas
    frsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqshkififd
    arpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypnieethwl
    snlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslamlmldgyyr
    tirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrqfptafef
    neyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftnplygsys
    nhvlypvasmrhlelwvgyyirwnpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gnhB (B:)
    meeppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvi
    nrvekiggassrgensygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlpl
    fafeykevfpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipd
    eelkrvasfrsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaq
    shkififdarpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivyp
    nieethwlsnlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslam
    lmldgyyrtirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtr
    qfptafefneyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledft
    nplygsysnhvlypvasmrhlelwvgyyirwnprmkpqepihnrykellakraelqkkve
    elqreisnrstssserasspaqcvtpvqtvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gnhB (B:)
    eppllpgenikdmakdvtyicpftgavrgtltvtnyrlyfksmerdppfvldaslgvinr
    vekiggnsygletvckdirnlrfahkpegrtrrsifenlmkyafpvsnnlplfafeykev
    fpengwklydplleyrrqgipneswritkineryelcdtypallvvpanipdeelkrvas
    frsrgripvlswihpesqatitrcsqpmvgvsgkrskedekylqaimdsnaqshkififd
    arpsvnavankakgggyesedayqnaelvfldihnihvmreslrklkeivypnieethwl
    snlesthwlehiklilagalriadkvesgktsvvvhssdgwdrtaqltslamlmldgyyr
    tirgfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrqfptafef
    neyflitildhlysclfgtflcnseqqrgkenlpkrtvslwsyinsqledftnplygsys
    nhvlypvasmrhlelwvgyyirwnpr