PDB entry 5gng

View 5gng on RCSB PDB site
Description: crystal structure of biog from haemophilus influenzae at 1.26 angstroms resolution
Deposited on 2016-07-20, released 2016-12-07
The last revision was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein HI_1552
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: HI_1552
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized protein HI_1552
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: HI_1552
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gngA (A:)
    mktkfydyqgehlilyfagwgtppdavnhlilpenhdllicydyqdlnldfdlsayrhir
    lvawsmgvwvaervlqgirlksatavngtglpcddsfgipyaifkgtlenltentrlkfe
    rricgdkasferyqlfparpfdeihqeltalfamiqqdkridlihwanawvssrdkiftp
    anqhqywalrcavqeiegehyvfsrfthwsalwdhlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gngA (A:)
    mktkfydyqgehlilyfagwgtppdavnhlilpenhdllicydyqdlnldfdlsayrhir
    lvawsmgvwvaervlqgirlksatavngtglpcddsfgipyaifkgtlenltentrlkfe
    rricgdkasferyqlfparpfdeihqeltalfamiqqdkridlihwanawvssrdkiftp
    anqhqywalrcavqeiegehyvfsrfthwsalwd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gngB (B:)
    mktkfydyqgehlilyfagwgtppdavnhlilpenhdllicydyqdlnldfdlsayrhir
    lvawsmgvwvaervlqgirlksatavngtglpcddsfgipyaifkgtlenltentrlkfe
    rricgdkasferyqlfparpfdeihqeltalfamiqqdkridlihwanawvssrdkiftp
    anqhqywalrcavqeiegehyvfsrfthwsalwdhlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gngB (B:)
    mktkfydyqgehlilyfagwgtppdavnhlilpenhdllicydyqdlnldfdlsayrhir
    lvawsmgvwvaervlqgirlksatavngtglpcddsfgipyaifkgtlenltentrlkfe
    rricgdkasferyqlfparpfdeihqeltalfamiqqdkridlihwanawvssrdkiftp
    anqhqywalrcavqeiegehyvfsrfthwsalwd