PDB entry 5gnc

View 5gnc on RCSB PDB site
Description: crystal structure of phytophthora. sojae psr2
Deposited on 2016-07-20, released 2017-08-16
The last revision was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Avh146
    Species: Phytophthora sojae [TaxId:67593]
    Gene: Avh
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gncA (A:)
    ssvpgfeklanllkpkpglkkllkwadakkppetvftrlrldktgtqlfdntdfpvwaay
    trsvaqtdseasavmlktlvsrysdevlsgmiaaakkssktesiatkleteqmrtwlaak
    ktpddmflvfklnkagddilsspllsawtnymklsnkenpkaqttliatmtkhygdsgvs
    qilaaarkspatqstakrleaeqvqlwlkkgrtpddtftllsldragddllaspqfntwm
    kyinyynkenpdekttvlaklmthfddeeltpilvvarkvpstestaaklqaeqfknwls
    adkspeeaftllqldkagddlltnpqltnwlkytenfnlnkeineqvtaiqvfraqyvdd
    srianmviaaekvpntqaiakrvedelfkgwtvvlnkpddvfinlkletvgenvfesplw
    sfytkflekyntanpgkeqtmisglargyndvtltnmllkakeapstktlatkledelvq
    ywladkklpdklfgylelkesvdgiltnpvfnvwlkylnafndkapvkkalmidtlksaf
    gdvavsnmlfaakkdpgtakvaatlqtallskwvlekktpgqvsailkegagadvsakll
    atysakfkvrwg
    

    Sequence, based on observed residues (ATOM records):
    >5gncA (A:)
    kpglkkllkwadakkppetvftrlrldktgtqlfdntdfpvwaaytrsvaqtdseasavm
    lktlvsrysdevlsgmiaaakkssktesiatkleteqmrtwlaakktpddmflvfklnka
    gddilsspllsawtnymklsnkenpkaqttliatmtkhygdsgvsqilaaarkspatqst
    akrleaeqvqlwlkkgrtpddtftllsldragddllaspqfntwmkyinyynkenpdekt
    tvlaklmthfddeeltpilvvarkvpstestaaklqaeqfknwlsadkspeeaftllqld
    kagddlltnpqltnwlkytenfnlnkeineqvtaiqvfraqyvddsrianmviaaekvpn
    tqaiakrvedelfkgwtvvlnkpddvfinlkletvgenvfesplwsfytkflekyntanp
    gkeqtmisglargyndvtltnmllkakeapstktlatkledelvqywladkklpdklfgy
    lelkesvdgiltnpvfnvwlkylnafndkapvkkalmidtlksafgdvavsnmlfaakkd
    pgtakvaatlqtallskwvlekktpgqvsailkegagadvsakllatysakfkvrwg