PDB entry 5gna

View 5gna on RCSB PDB site
Description: crystal structure of flagellin assembly related protein
Deposited on 2016-07-20, released 2017-08-02
The last revision was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flagellar protein FliT
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: fliT, STM1962
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A1N2 (2-95)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Flagellar hook-associated protein 2
    Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) [TaxId:99287]
    Gene: fliD, flaV, flbC, STM1960
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5gnaA (A:)
    gsmtstvefinrwqriallsqsllelaqrgewdlllqqevsylqsietvmekqtppgitr
    siqdmvagyikqtldneqllkgllqqrldelsslig
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gnaB (B:)
    dgiidnaqdnvnatlksltkqylsvsnsidetvarykaqftqldtmmsklnntssyltqq
    ftamnks
    

    Sequence, based on observed residues (ATOM records):
    >5gnaB (B:)
    natlksltkqylsvsnsidetvarykaqftqldtmmsklnntssyltqqftamnks