PDB entry 5gn9

View 5gn9 on RCSB PDB site
Description: crystal structure of alternative oxidase from trypanosoma brucei brucei complexed with cumarin derivative-17b
Deposited on 2016-07-19, released 2017-07-26
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alternative oxidase, mitochondrial
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: AOX
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Alternative oxidase, mitochondrial
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: AOX
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Alternative oxidase, mitochondrial
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: AOX
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Alternative oxidase, mitochondrial
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: AOX
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, 6Y0

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gn9A (A:)
    mfrnhasritaaaapwvlrtacrqksdaktpvwghtqlnrlsfletvpvvplrvsdesse
    drptwslpdienvaithkkpnglvdtlayrsvrtcrwlfdtfslyrfgsiteskvisrcl
    fletvagvpgmvggmlrhlsslrymtrdkgwintllveaenermhlmtfielrqpglplr
    vsiiitqaimylfllvayvisprfvhrfvgyleeeavitytgvmraidegrlrptkndvp
    evarvywnlsknatfrdlinviradeaehrvvnhtfadmhekrlqnsvnpfvvlkknpee
    mysnqpsgktrtdfgsegaktasnvnkhv
    

    Sequence, based on observed residues (ATOM records):
    >5gn9A (A:)
    vwghtqlnrlsfletvpvvplrvsdessedrptwslpdienvaithkkpnglvdtlayrs
    vrtcrwlfdtfslyrfgsiteskvisrclfletvagvpgmvggmlrhlsslrymtrdkgw
    intllveaenermhlmtfielrqpglplrvsiiitqaimylfllvayvisprfvhrfvgy
    leeeavitytgvmraidegrlrptkndvpevarvywnlsknatfrdlinviradeaehrv
    vnhtfadmhekrlqnsvnpfvvlk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gn9B (B:)
    mfrnhasritaaaapwvlrtacrqksdaktpvwghtqlnrlsfletvpvvplrvsdesse
    drptwslpdienvaithkkpnglvdtlayrsvrtcrwlfdtfslyrfgsiteskvisrcl
    fletvagvpgmvggmlrhlsslrymtrdkgwintllveaenermhlmtfielrqpglplr
    vsiiitqaimylfllvayvisprfvhrfvgyleeeavitytgvmraidegrlrptkndvp
    evarvywnlsknatfrdlinviradeaehrvvnhtfadmhekrlqnsvnpfvvlkknpee
    mysnqpsgktrtdfgsegaktasnvnkhv
    

    Sequence, based on observed residues (ATOM records):
    >5gn9B (B:)
    vwghtqlnrlsfletvpvvplrvsdessedrptwslpdienvaithkkpnglvdtlayrs
    vrtcrwlfdtfslyrfgsiteskvisrclfletvagvpgmvggmlrhlsslrymtrdkgw
    intllveaenermhlmtfielrqpglplrvsiiitqaimylfllvayvisprfvhrfvgy
    leeeavitytgvmraidegrlrptkndvpevarvywnlsknatfrdlinviradeaehrv
    vnhtfadmhekrlqnsvnpfvvlk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gn9C (C:)
    mfrnhasritaaaapwvlrtacrqksdaktpvwghtqlnrlsfletvpvvplrvsdesse
    drptwslpdienvaithkkpnglvdtlayrsvrtcrwlfdtfslyrfgsiteskvisrcl
    fletvagvpgmvggmlrhlsslrymtrdkgwintllveaenermhlmtfielrqpglplr
    vsiiitqaimylfllvayvisprfvhrfvgyleeeavitytgvmraidegrlrptkndvp
    evarvywnlsknatfrdlinviradeaehrvvnhtfadmhekrlqnsvnpfvvlkknpee
    mysnqpsgktrtdfgsegaktasnvnkhv
    

    Sequence, based on observed residues (ATOM records):
    >5gn9C (C:)
    vwghtqlnrlsfletvpvvplrvsdessedrptwslpdienvaithkkpnglvdtlayrs
    vrtcrwlfdtfslyrfgsiteskvisrclfletvagvpgmvggmlrhlsslrymtrdkgw
    intllveaenermhlmtfielrqpglplrvsiiitqaimylfllvayvisprfvhrfvgy
    leeeavitytgvmraidegrlrptkndvpevarvywnlsknatfrdlinviradeaehrv
    vnhtfadmhekrlqnsvnpfvvlk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gn9D (D:)
    mfrnhasritaaaapwvlrtacrqksdaktpvwghtqlnrlsfletvpvvplrvsdesse
    drptwslpdienvaithkkpnglvdtlayrsvrtcrwlfdtfslyrfgsiteskvisrcl
    fletvagvpgmvggmlrhlsslrymtrdkgwintllveaenermhlmtfielrqpglplr
    vsiiitqaimylfllvayvisprfvhrfvgyleeeavitytgvmraidegrlrptkndvp
    evarvywnlsknatfrdlinviradeaehrvvnhtfadmhekrlqnsvnpfvvlkknpee
    mysnqpsgktrtdfgsegaktasnvnkhv
    

    Sequence, based on observed residues (ATOM records):
    >5gn9D (D:)
    vwghtqlnrlsfletvpvvplrvsdessedrptwslpdienvaithkkpnglvdtlayrs
    vrtcrwlfdtfslyrfgsiteskvisrclfletvagvpgmvggmlrhlsslrymtrdkgw
    intllveaenermhlmtfielrqpglplrvsiiitqaimylfllvayvisprfvhrfvgy
    leeeavitytgvmraidegrlrptkndvpevarvywnlsknatfrdlinviradeaehrv
    vnhtfadmhekrlqnsvnpfvvlk