PDB entry 5gn8

View 5gn8 on RCSB PDB site
Description: Structure of a 48-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign
Class: oxidoreductase
Keywords: ferritin, nanocage, subunit interface redesign, OXIDOREDUCTASE
Deposited on 2016-07-19, released 2016-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gn8a_
  • Chain 'B':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gn8A (A:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhkl
    atdkndphlcdfiethylikelgdhvtnlrkmgapesglaeylfdkhtlgdsdnes
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gn8A (A:)
    qnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaekl
    mklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdkndphl
    cdfiethylikelgdhvtnlrkmgapesglaeylfdkhtlgd
    

  • Chain 'B':
    No sequence available.