PDB entry 5gn3

View 5gn3 on RCSB PDB site
Description: structure of selenomethionine-labelled uracil dna glycosylase (bdiung) from bradyrhizobium diazoefficiens
Deposited on 2016-07-19, released 2017-05-03
The last revision was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Blr0248 protein
    Species: Bradyrhizobium diazoefficiens USDA 110 [TaxId:224911]
    Gene: blr0248
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Blr0248 protein
    Species: Bradyrhizobium diazoefficiens USDA 110 [TaxId:224911]
    Gene: blr0248
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Blr0248 protein
    Species: Bradyrhizobium diazoefficiens USDA 110 [TaxId:224911]
    Gene: blr0248
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Blr0248 protein
    Species: Bradyrhizobium diazoefficiens USDA 110 [TaxId:224911]
    Gene: blr0248
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5gn3A (A:)
    mltefdagygeqpfrdlcanypgaeaydphdfriewgpifhrgrldgsarvlivgqdpaq
    hetivrrilvgtagrrtqgflaklgivqsyvmvntflysvygqsggskhknepgivdyrn
    kwfkavlgpgnieavvslggladeawkawlkssdgaayktlayqhithptwpessahdsa
    tqaantkimlakwnaalaalapevkhpdvpttlvpygdafkpselvdiiakdlpaglpaw
    mrgdtpwavrqgvdaaakrrtimitipdgvip
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5gn3B (B:)
    mltefdagygeqpfrdlcanypgaeaydphdfriewgpifhrgrldgsarvlivgqdpaq
    hetivrrilvgtagrrtqgflaklgivqsyvmvntflysvygqsggskhknepgivdyrn
    kwfkavlgpgnieavvslggladeawkawlkssdgaayktlayqhithptwpessahdsa
    tqaantkimlakwnaalaalapevkhpdvpttlvpygdafkpselvdiiakdlpaglpaw
    mrgdtpwavrqgvdaaakrrtimitipdgvip
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5gn3C (C:)
    mltefdagygeqpfrdlcanypgaeaydphdfriewgpifhrgrldgsarvlivgqdpaq
    hetivrrilvgtagrrtqgflaklgivqsyvmvntflysvygqsggskhknepgivdyrn
    kwfkavlgpgnieavvslggladeawkawlkssdgaayktlayqhithptwpessahdsa
    tqaantkimlakwnaalaalapevkhpdvpttlvpygdafkpselvdiiakdlpaglpaw
    mrgdtpwavrqgvdaaakrrtimitipdgvip
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5gn3D (D:)
    mltefdagygeqpfrdlcanypgaeaydphdfriewgpifhrgrldgsarvlivgqdpaq
    hetivrrilvgtagrrtqgflaklgivqsyvmvntflysvygqsggskhknepgivdyrn
    kwfkavlgpgnieavvslggladeawkawlkssdgaayktlayqhithptwpessahdsa
    tqaantkimlakwnaalaalapevkhpdvpttlvpygdafkpselvdiiakdlpaglpaw
    mrgdtpwavrqgvdaaakrrtimitipdgvip