PDB entry 5gmx

View 5gmx on RCSB PDB site
Description: crystal structure of a family viii carboxylesterase
Deposited on 2016-07-18, released 2017-07-26
The last revision was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxylesterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: carboxylesterase
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PMS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gmxA (A:)
    mstgieiqgicapeftkvrdafaanfkdgkevgasfglaiegeivvdlwggfadagrsrp
    wrsdtlintysttkgmaatvvgvladeglidynarvadywpefaaagkkdvtvaqllshq
    agicgprervemadlydwdklcamlaaqwpffepgtangyhavvfghiagevarrvtgrt
    kslgqlfaekvaspigagndyyiglpasedhrvaemlpvigseqlgtglggkkrmsdaly
    camahppltahiandrawraaevpgangqgngrgiakvygalanggtlggtriisakgia
    emtreecfrkdevigvrmrwsrgfilnkaelygpnpdafghsgwggsfgfadtkarlgmg
    yamnqmdtnifgdprgvrlieaayrclpnslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gmxA (A:)
    ieiqgicapeftkvrdafaanfkdgkevgasfglaiegeivvdlwggfadagrsrpwrsd
    tlintysttkgmaatvvgvladeglidynarvadywpefaaagkkdvtvaqllshqagic
    gprervemadlydwdklcamlaaqwpffepgtangyhavvfghiagevarrvtgrtkslg
    qlfaekvaspigagndyyiglpasedhrvaemlpvrmsdalycamahppltahiandraw
    raaevpgangqgngrgiakvygalanggtlggtriisakgiaemtreecfrkdevigvrm
    rwsrgfilnkaelygpnpdafghsgwggsfgfadtkarlgmgyamnqmdtnifgdprgvr
    lieaayrcl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gmxB (B:)
    mstgieiqgicapeftkvrdafaanfkdgkevgasfglaiegeivvdlwggfadagrsrp
    wrsdtlintysttkgmaatvvgvladeglidynarvadywpefaaagkkdvtvaqllshq
    agicgprervemadlydwdklcamlaaqwpffepgtangyhavvfghiagevarrvtgrt
    kslgqlfaekvaspigagndyyiglpasedhrvaemlpvigseqlgtglggkkrmsdaly
    camahppltahiandrawraaevpgangqgngrgiakvygalanggtlggtriisakgia
    emtreecfrkdevigvrmrwsrgfilnkaelygpnpdafghsgwggsfgfadtkarlgmg
    yamnqmdtnifgdprgvrlieaayrclpnslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gmxB (B:)
    ieiqgicapeftkvrdafaanfkdgkevgasfglaiegeivvdlwggfadagrsrpwrsd
    tlintysttkgmaatvvgvladeglidynarvadywpefaaagkkdvtvaqllshqagic
    gprervemadlydwdklcamlaaqwpffepgtangyhavvfghiagevarrvtgrtkslg
    qlfaekvaspigagndyyiglpasedhrvaemlpvrmsdalycamahppltahiandraw
    raaevpgangqgngrgiakvygalanggtlggtriisakgiaemtreecfrkdevigvrm
    rwsrgfilnkaelygpnpdafghsgwggsfgfadtkarlgmgyamnqmdtnifgdprgvr
    lieaayrcl