PDB entry 5gmt

View 5gmt on RCSB PDB site
Description: crystal structure of the marine pl-14 alginate lyase from aplysia kurodai
Deposited on 2016-07-16, released 2017-01-04
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alginate lyase
    Species: Aplysia kurodai [TaxId:6501]
    Gene: AkAly30
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Alginate lyase
    Species: Aplysia kurodai [TaxId:6501]
    Gene: AkAly30
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gmtA (A:)
    mrgshhhhhhgsattvwslssvphsshvstilghfkpiyhdwgddsiststkhsssralr
    ifyekgsyskvhdhrgagfysrpsaisssvdamilkydvyfenfgfgiggklpglfggen
    gegaykcsggsnpsscfslrlmwrkdgdgelyayiptnqesgfkdrddviahstygqslg
    rgkfrfmnnkwhsiseevhintvgktdgwvkicvqaeghsqqcytanhlrmrntnshhlr
    gmffstffggseksyaapndcysyfknfqiltpshavvg
    

    Sequence, based on observed residues (ATOM records):
    >5gmtA (A:)
    attvwslssvphsshvstilghfkpiyhdwgddsiststkhsssralrifyekgsyskvh
    dhrgagfysrpsaisssvdamilkydvyfenfgfgiggklpglfggengegaykcsggsn
    psscfslrlmwrkdgdgelyayiptnqesgfkdrddviahstygqslgrgkfrfmnnkwh
    siseevhintvgktdgwvkicvqaeghsqqcytanhlrmrntnshhlrgmffstffggse
    ksyaapndcysyfknfqiltpshavvg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gmtB (B:)
    mrgshhhhhhgsattvwslssvphsshvstilghfkpiyhdwgddsiststkhsssralr
    ifyekgsyskvhdhrgagfysrpsaisssvdamilkydvyfenfgfgiggklpglfggen
    gegaykcsggsnpsscfslrlmwrkdgdgelyayiptnqesgfkdrddviahstygqslg
    rgkfrfmnnkwhsiseevhintvgktdgwvkicvqaeghsqqcytanhlrmrntnshhlr
    gmffstffggseksyaapndcysyfknfqiltpshavvg
    

    Sequence, based on observed residues (ATOM records):
    >5gmtB (B:)
    attvwslssvphsshvstilghfkpiyhdwgddsiststkhsssralrifyekgsyskvh
    dhrgagfysrpsaisssvdamilkydvyfenfgfgiggklpglfggengegaykcsggsn
    psscfslrlmwrkdgdgelyayiptnqesgfkdrddviahstygqslgrgkfrfmnnkwh
    siseevhintvgktdgwvkicvqaeghsqqcytanhlrmrntnshhlrgmffstffggse
    ksyaapndcysyfknfqiltp