PDB entry 5gmo

View 5gmo on RCSB PDB site
Description: X-ray structure of carbonyl reductase SsCR
Class: oxidoreductase
Keywords: carbonyl reductase, OXIDOREDUCTASE
Deposited on 2016-07-14, released 2017-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein induced by osmotic stress
    Species: Scheffersomyces stipitis CBS 6054 [TaxId:322104]
    Gene: GRP3.1, PICST_32463
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5gmoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gmoA (A:)
    mttsvfvsgatgylaqqiialvlskgykvvgsvrseekganlkklygddfsyevvkvleq
    kgafdealkkhpevtiflhtaspvtfevedtekeilipaingtkyvlqsikdvapqitrv
    vytssvvamsvpeelgspdvvlseaswsslsyeqskthgvlayfgskqfaeraawefveq
    ekpnfalstvnpvyifgpqakdeevkgtlnlsaemvnsvlklnkdddvpattgtfidvrd
    vakahlaafekdeakgerlllsntrfngqtlldvvrknfpqladklpvgkphsddfsafk
    ewndkktkkilgfeyfdfetsvvdsikqvlkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmoA (A:)
    mttsvfvsgatgylaqqiialvlskgykvvgsvrseekganlkklygddfsyevvkvleq
    kgafdealkkhpevtiflhtaspvtfevedtekeilipaingtkyvlqsikdvapqitrv
    vytssvvamsvpeelgspdvvlseaswsslsyeqskthgvlayfgskqfaeraawefveq
    ekpnfalstvnpvyifgpqakdeevkgtlnlsaemvnsvlklnkdddvpattgtfidvrd
    vakahlaafekdeakgerlllsntrfngqtlldvvrknfpqladklpvgkphsddfsafk
    ewndkktkkilgfeyfdfetsvvdsikqvlk