PDB entry 5gmf

View 5gmf on RCSB PDB site
Description: crystal structure of monkey tlr7 in complex with guanosine and polyu
Deposited on 2016-07-14, released 2016-11-02
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toll-like receptor 7
    Species: Macaca mulatta [TaxId:9544]
    Gene: TLR7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3Y653 (4-End)
      • expression tag (1-3)
      • engineered mutation (144)
      • engineered mutation (366)
      • engineered mutation (776)
  • Chain 'B':
    Compound: Toll-like receptor 7
    Species: Macaca mulatta [TaxId:9544]
    Gene: TLR7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3Y653 (4-End)
      • expression tag (1-3)
      • engineered mutation (144)
      • engineered mutation (366)
      • engineered mutation (776)
  • Chain 'C':
    Compound: Toll-like receptor 7
    Species: Macaca mulatta [TaxId:9544]
    Gene: TLR7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3Y653 (4-End)
      • expression tag (1-3)
      • engineered mutation (144)
      • engineered mutation (366)
      • engineered mutation (776)
  • Chain 'D':
    Compound: Toll-like receptor 7
    Species: Macaca mulatta [TaxId:9544]
    Gene: TLR7
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3Y653 (4-End)
      • expression tag (1-3)
      • engineered mutation (144)
      • engineered mutation (366)
      • engineered mutation (776)
  • Chain 'E':
    Compound: RNA (5'-r(p*up*up*up*u)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'F':
    Compound: RNA (5'-r(p*up*up*up*u)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'G':
    Compound: RNA (5'-r(p*up*up*up*u)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'H':
    Compound: RNA (5'-r(p*up*up*up*u)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: CA, NAG, GMP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gmfA (A:)
    rspwarwfpktlpcdvtldvsknhvivdctdkhlteipggiptnttnltltinhipdisp
    asfhrlvhlveidfrcncvpirlgsksnmcprrlqikprsfsgltylkslyldgnqllei
    pqglppslqllsleannifsirkeqltelanieilylgqncyyrnpcyvsysiekdafln
    ltklkvlslkdnnvttvptvlpstltelylynnmiaeiqeddfnnlnqlqildlsgncpr
    cynapfpctpcknnsplqipvnafdaltelkvlrlhsnslqhvpprwfkninnlqeldls
    qnflakeigdakflhflpnliqldlsfnfelqvyrasmnlsqafsslkslkilrirgyvf
    kelksfqlsplhnlqnlevldlgtnfikianlsmfkqfkrlkvidlsvnkispsgdssev
    gfcsnartsvesyepqvleqlyyfrydkyarscrfknkeasftsvqescykygqtldlsk
    nsiffikssdfqhlsflkclnlsgnlisqtlngsefqplaelryldfsnnrldllhstaf
    eelrklevldissnshyfqsegithmlnftknlkvlqklmmndndissstsrtmeseslr
    tlefrgnhldvlwrdgdnrylqlfknllkleeldisknslsflpsgvfdgmppnlknlsl
    aknglksfiweklrylknletldlshnqlttvperlsncsrslknlilknnqirsltkyf
    lqdafqlryldlssnkiqmiqktsfpenvlnnlkmlllhhnrflctcdavwfvwwvqhte
    vtipylatdvtcvgpgahkgqsvisldlytceldltn
    

    Sequence, based on observed residues (ATOM records):
    >5gmfA (A:)
    spwarwfpktlpcdvtldvsknhvivdctdkhlteipggiptnttnltltinhipdispa
    sfhrlvhlveidfrcncvpirlgsksnmcprrlqikprsfsgltylkslyldgnqlleip
    qglppslqllsleannifsirkeqltelanieilylgqncyyrnpcyvsysiekdaflnl
    tklkvlslkdnnvttvptvlpstltelylynnmiaeiqeddfnnlnqlqildlsgncprc
    ynapfpctpcknnsplqipvnafdaltelkvlrlhsnslqhvpprwfkninnlqeldlsq
    nflakeigdakflhflpnliqldlsfnfelqvyrasmnlsqafsslkslkilrirgyvfk
    elksfqlsplhnlqnlevldlgtnfikianlsmfkqfkrlkvidlsvnkispvleqlyyf
    rydkyarscrfkscykygqtldlsknsiffikssdfqhlsflkclnlsgnlisqtlngse
    fqplaelryldfsnnrldllhstafeelrklevldissnshyfqsegithmlnftknlkv
    lqklmmndndissstsrtmeseslrtlefrgnhldvlwrdgdnrylqlfknllkleeldi
    sknslsflpsgvfdgmppnlknlslaknglksfiweklrylknletldlshnqlttvper
    lsncsrslknlilknnqirsltkyflqdafqlryldlssnkiqmiqktsfpenvlnnlkm
    lllhhnrflctcdavwfvwwvqhtevtipylatdvtcvgpgahkgqsvisldlytc
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gmfB (B:)
    rspwarwfpktlpcdvtldvsknhvivdctdkhlteipggiptnttnltltinhipdisp
    asfhrlvhlveidfrcncvpirlgsksnmcprrlqikprsfsgltylkslyldgnqllei
    pqglppslqllsleannifsirkeqltelanieilylgqncyyrnpcyvsysiekdafln
    ltklkvlslkdnnvttvptvlpstltelylynnmiaeiqeddfnnlnqlqildlsgncpr
    cynapfpctpcknnsplqipvnafdaltelkvlrlhsnslqhvpprwfkninnlqeldls
    qnflakeigdakflhflpnliqldlsfnfelqvyrasmnlsqafsslkslkilrirgyvf
    kelksfqlsplhnlqnlevldlgtnfikianlsmfkqfkrlkvidlsvnkispsgdssev
    gfcsnartsvesyepqvleqlyyfrydkyarscrfknkeasftsvqescykygqtldlsk
    nsiffikssdfqhlsflkclnlsgnlisqtlngsefqplaelryldfsnnrldllhstaf
    eelrklevldissnshyfqsegithmlnftknlkvlqklmmndndissstsrtmeseslr
    tlefrgnhldvlwrdgdnrylqlfknllkleeldisknslsflpsgvfdgmppnlknlsl
    aknglksfiweklrylknletldlshnqlttvperlsncsrslknlilknnqirsltkyf
    lqdafqlryldlssnkiqmiqktsfpenvlnnlkmlllhhnrflctcdavwfvwwvqhte
    vtipylatdvtcvgpgahkgqsvisldlytceldltn
    

    Sequence, based on observed residues (ATOM records):
    >5gmfB (B:)
    spwarwfpktlpcdvtldvsknhvivdctdkhlteipggiptnttnltltinhipdispa
    sfhrlvhlveidfrcncvpirlgsksnmcprrlqikprsfsgltylkslyldgnqlleip
    qglppslqllsleannifsirkeqltelanieilylgqncyyrnpcyvsysiekdaflnl
    tklkvlslkdnnvttvptvlpstltelylynnmiaeiqeddfnnlnqlqildlsgncprc
    ynapfpctpcknnsplqipvnafdaltelkvlrlhsnslqhvpprwfkninnlqeldlsq
    nflakeigdakflhflpnliqldlsfnfelqvyrasmnlsqafsslkslkilrirgyvfk
    elksfqlsplhnlqnlevldlgtnfikianlsmfkqfkrlkvidlsvnkispvleqlyyf
    rydkyarscrfkscykygqtldlsknsiffikssdfqhlsflkclnlsgnlisqtlngse
    fqplaelryldfsnnrldllhstafeelrklevldissnshyfqsegithmlnftknlkv
    lqklmmndndissstsrtmeseslrtlefrgnhldvlwrdgdnrylqlfknllkleeldi
    sknslsflpsgvfdgmppnlknlslaknglksfiweklrylknletldlshnqlttvper
    lsncsrslknlilknnqirsltkyflqdafqlryldlssnkiqmiqktsfpenvlnnlkm
    lllhhnrflctcdavwfvwwvqhtevtipylatdvtcvgpgahkgqsvisldlytc
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gmfC (C:)
    rspwarwfpktlpcdvtldvsknhvivdctdkhlteipggiptnttnltltinhipdisp
    asfhrlvhlveidfrcncvpirlgsksnmcprrlqikprsfsgltylkslyldgnqllei
    pqglppslqllsleannifsirkeqltelanieilylgqncyyrnpcyvsysiekdafln
    ltklkvlslkdnnvttvptvlpstltelylynnmiaeiqeddfnnlnqlqildlsgncpr
    cynapfpctpcknnsplqipvnafdaltelkvlrlhsnslqhvpprwfkninnlqeldls
    qnflakeigdakflhflpnliqldlsfnfelqvyrasmnlsqafsslkslkilrirgyvf
    kelksfqlsplhnlqnlevldlgtnfikianlsmfkqfkrlkvidlsvnkispsgdssev
    gfcsnartsvesyepqvleqlyyfrydkyarscrfknkeasftsvqescykygqtldlsk
    nsiffikssdfqhlsflkclnlsgnlisqtlngsefqplaelryldfsnnrldllhstaf
    eelrklevldissnshyfqsegithmlnftknlkvlqklmmndndissstsrtmeseslr
    tlefrgnhldvlwrdgdnrylqlfknllkleeldisknslsflpsgvfdgmppnlknlsl
    aknglksfiweklrylknletldlshnqlttvperlsncsrslknlilknnqirsltkyf
    lqdafqlryldlssnkiqmiqktsfpenvlnnlkmlllhhnrflctcdavwfvwwvqhte
    vtipylatdvtcvgpgahkgqsvisldlytceldltn
    

    Sequence, based on observed residues (ATOM records):
    >5gmfC (C:)
    spwarwfpktlpcdvtldvsknhvivdctdkhlteipggiptnttnltltinhipdispa
    sfhrlvhlveidfrcncvpirlgsksnmcprrlqikprsfsgltylkslyldgnqlleip
    qglppslqllsleannifsirkeqltelanieilylgqncyyrnpcyvsysiekdaflnl
    tklkvlslkdnnvttvptvlpstltelylynnmiaeiqeddfnnlnqlqildlsgncprc
    ynapfpctpcknnsplqipvnafdaltelkvlrlhsnslqhvpprwfkninnlqeldlsq
    nflakeigdakflhflpnliqldlsfnfelqvyrasmnlsqafsslkslkilrirgyvfk
    elksfqlsplhnlqnlevldlgtnfikianlsmfkqfkrlkvidlsvnkispvleqlyyf
    rydkyarscrfkscykygqtldlsknsiffikssdfqhlsflkclnlsgnlisqtlngse
    fqplaelryldfsnnrldllhstafeelrklevldissnshyfqsegithmlnftknlkv
    lqklmmndndissstsrtmeseslrtlefrgnhldvlwrdgdnrylqlfknllkleeldi
    sknslsflpsgvfdgmppnlknlslaknglksfiweklrylknletldlshnqlttvper
    lsncsrslknlilknnqirsltkyflqdafqlryldlssnkiqmiqktsfpenvlnnlkm
    lllhhnrflctcdavwfvwwvqhtevtipylatdvtcvgpgahkgqsvisldlytc
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gmfD (D:)
    rspwarwfpktlpcdvtldvsknhvivdctdkhlteipggiptnttnltltinhipdisp
    asfhrlvhlveidfrcncvpirlgsksnmcprrlqikprsfsgltylkslyldgnqllei
    pqglppslqllsleannifsirkeqltelanieilylgqncyyrnpcyvsysiekdafln
    ltklkvlslkdnnvttvptvlpstltelylynnmiaeiqeddfnnlnqlqildlsgncpr
    cynapfpctpcknnsplqipvnafdaltelkvlrlhsnslqhvpprwfkninnlqeldls
    qnflakeigdakflhflpnliqldlsfnfelqvyrasmnlsqafsslkslkilrirgyvf
    kelksfqlsplhnlqnlevldlgtnfikianlsmfkqfkrlkvidlsvnkispsgdssev
    gfcsnartsvesyepqvleqlyyfrydkyarscrfknkeasftsvqescykygqtldlsk
    nsiffikssdfqhlsflkclnlsgnlisqtlngsefqplaelryldfsnnrldllhstaf
    eelrklevldissnshyfqsegithmlnftknlkvlqklmmndndissstsrtmeseslr
    tlefrgnhldvlwrdgdnrylqlfknllkleeldisknslsflpsgvfdgmppnlknlsl
    aknglksfiweklrylknletldlshnqlttvperlsncsrslknlilknnqirsltkyf
    lqdafqlryldlssnkiqmiqktsfpenvlnnlkmlllhhnrflctcdavwfvwwvqhte
    vtipylatdvtcvgpgahkgqsvisldlytceldltn
    

    Sequence, based on observed residues (ATOM records):
    >5gmfD (D:)
    spwarwfpktlpcdvtldvsknhvivdctdkhlteipggiptnttnltltinhipdispa
    sfhrlvhlveidfrcncvpirlgsksnmcprrlqikprsfsgltylkslyldgnqlleip
    qglppslqllsleannifsirkeqltelanieilylgqncyyrnpcyvsysiekdaflnl
    tklkvlslkdnnvttvptvlpstltelylynnmiaeiqeddfnnlnqlqildlsgncprc
    ynapfpctpcknnsplqipvnafdaltelkvlrlhsnslqhvpprwfkninnlqeldlsq
    nflakeigdakflhflpnliqldlsfnfelqvyrasmnlsqafsslkslkilrirgyvfk
    elksfqlsplhnlqnlevldlgtnfikianlsmfkqfkrlkvidlsvnkispvleqlyyf
    rydkyarscrfkscykygqtldlsknsiffikssdfqhlsflkclnlsgnlisqtlngse
    fqplaelryldfsnnrldllhstafeelrklevldissnshyfqsegithmlnftknlkv
    lqklmmndndissstsrtmeseslrtlefrgnhldvlwrdgdnrylqlfknllkleeldi
    sknslsflpsgvfdgmppnlknlslaknglksfiweklrylknletldlshnqlttvper
    lsncsrslknlilknnqirsltkyflqdafqlryldlssnkiqmiqktsfpenvlnnlkm
    lllhhnrflctcdavwfvwwvqhtevtipylatdvtcvgpgahkgqsvisldlytc
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.