PDB entry 5gmc

View 5gmc on RCSB PDB site
Description: methylation at position 32 of trna catalyzed by trmj alters oxidative stress response in pseudomonas aeruiginosa
Deposited on 2016-07-13, released 2016-10-26
The last revision was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (cytidine/uridine-2'-o-)-methyltransferase trmj
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: trmJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: tRNA (cytidine/uridine-2'-o-)-methyltransferase trmj
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: trmJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: tRNA (cytidine/uridine-2'-o-)-methyltransferase trmj
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: trmJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: tRNA (cytidine/uridine-2'-o-)-methyltransferase trmj
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: trmJ
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5gmcA (A:)
    nlyfqsmmldrirvvlvntshpgniggaaramknmglsqlvlvqpesfphgdavarasga
    tdildaarvvdtleealsgcsvvlgtsardrripwplldprecattclehleangevalv
    fgreyagltneelqrcqfhvhipsdpefgslnlaaavqvltyevrmawlaaqgk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gmcB (B:)
    nlyfqsmmldrirvvlvntshpgniggaaramknmglsqlvlvqpesfphgdavarasga
    tdildaarvvdtleealsgcsvvlgtsardrripwplldprecattclehleangevalv
    fgreyagltneelqrcqfhvhipsdpefgslnlaaavqvltyevrmawlaaqgk
    

    Sequence, based on observed residues (ATOM records):
    >5gmcB (B:)
    fqsmmldrirvvlvntshpgniggaaramknmglsqlvlvqpesfphgdavarasgatdi
    ldaarvvdtleealsgcsvvlgtsardrripwplldprecattclehleangevalvfgr
    eyagltneelqrcqfhvhipsdpefgslnlaaavqvltyevrmawlaaqgk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gmcC (C:)
    nlyfqsmmldrirvvlvntshpgniggaaramknmglsqlvlvqpesfphgdavarasga
    tdildaarvvdtleealsgcsvvlgtsardrripwplldprecattclehleangevalv
    fgreyagltneelqrcqfhvhipsdpefgslnlaaavqvltyevrmawlaaqgk
    

    Sequence, based on observed residues (ATOM records):
    >5gmcC (C:)
    smmldrirvvlvntshpgniggaaramknmglsqlvlvqpesfphgdavarasgatdild
    aarvvdtleealsgcsvvlgtsardrripwplldprecattclehleangevalvfgrey
    agltneelqrcqfhvhipsdpefgslnlaaavqvltyevrmawlaaqgk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gmcD (D:)
    nlyfqsmmldrirvvlvntshpgniggaaramknmglsqlvlvqpesfphgdavarasga
    tdildaarvvdtleealsgcsvvlgtsardrripwplldprecattclehleangevalv
    fgreyagltneelqrcqfhvhipsdpefgslnlaaavqvltyevrmawlaaqgk
    

    Sequence, based on observed residues (ATOM records):
    >5gmcD (D:)
    yfqsmmldrirvvlvntshpgniggaaramknmglsqlvlvqpesfphgdavarasgatd
    ildaarvvdtleealsgcsvvlgtsardrripwplldprecattclehleangevalvfg
    reyagltneelqrcqfhvhipsdpefgslnlaaavqvltyevrmawlaaqgk