PDB entry 5gma

View 5gma on RCSB PDB site
Description: Crystal structure of the P228A variant of Thermotoga maritima acetyl esterase
Class: hydrolase
Keywords: hydrolase, carbohydrate metabolism, cephalosporin deacetylase, rossman fold
Deposited on 2016-07-13, released 2017-06-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2 (12-End)
      • expression tag (11)
      • engineered mutation (239)
    Domains in SCOPe 2.06: d5gmaa1, d5gmaa2
  • Chain 'B':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2 (12-End)
      • expression tag (11)
      • engineered mutation (239)
    Domains in SCOPe 2.06: d5gmab1, d5gmab2
  • Chain 'C':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2 (12-End)
      • expression tag (11)
      • engineered mutation (239)
    Domains in SCOPe 2.06: d5gmac1, d5gmac2
  • Chain 'D':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2 (12-End)
      • expression tag (11)
      • engineered mutation (239)
    Domains in SCOPe 2.06: d5gmad1, d5gmad2
  • Chain 'E':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2 (12-End)
      • expression tag (11)
      • engineered mutation (239)
    Domains in SCOPe 2.06: d5gmae1, d5gmae2
  • Chain 'F':
    Compound: Cephalosporin-C deacetylase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: axeA, TM_0077
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WXT2 (12-End)
      • expression tag (11)
      • engineered mutation (239)
    Domains in SCOPe 2.06: d5gmaf1, d5gmaf2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gmaA (A:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdtha
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmaA (A:)
    hmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydv
    tfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrg
    qgsgwlkgdtpdypgpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqe
    riviaggsqgggialavsalskkakallcdvpflchfrravqlvdthayaeitnflkthr
    dkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypy
    nnhegggsfqaveqvkflkklfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gmaB (B:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdtha
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmaB (B:)
    hmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydv
    tfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrg
    qgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdq
    eriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthayaeitnflkth
    rdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriyp
    ynnhegggsfqaveqvkflkklfe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gmaC (C:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdtha
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmaC (C:)
    hmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydv
    tfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrg
    qgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdq
    eriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthayaeitnflkth
    rdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriyp
    ynnhegggsfqaveqvkflkklfe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gmaD (D:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdtha
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmaD (D:)
    hmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydv
    tfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrg
    qgsgwlkgdtpdypgpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqe
    riviaggsqgggialavsalskkakallcdvpflchfrravqlvdthayaeitnflkthr
    dkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypy
    nnhegggsfqaveqvkflkklfe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5gmaE (E:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdtha
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmaE (E:)
    hmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydv
    tfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrg
    qgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdq
    eriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthayaeitnflkth
    rdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriyp
    ynnhegggsfqaveqvkflkklfe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5gmaF (F:)
    mgsdkihhhhhhmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvferme
    shlktveaydvtfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsm
    gyicfvmdtrgqgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavrav
    eaaasfpqvdqeriviaggsqgggialavsalskkakallcdvpflchfrravqlvdtha
    yaeitnflkthrdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaayny
    yagpkeiriypynnhegggsfqaveqvkflkklfekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gmaF (F:)
    hmaffdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydv
    tfsgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrg
    qgsgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdq
    eriviaggsqgggialavsalskkakallcdvpflchfrravqlvdthayaeitnflkth
    rdkeeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriyp
    ynnhegggsfqaveqvkflkklfe