PDB entry 5gm9

View 5gm9 on RCSB PDB site
Description: Crystal structure of a glycoside hydrolase in complex with cellobiose
Class: hydrolase
Keywords: substrate binding, cellulase, inhibitor, HYDROLASE
Deposited on 2016-07-13, released 2017-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoside hydrolase family 45 protein
    Species: Thielavia terrestris NRRL 8126 [TaxId:578455]
    Gene: THITE_2110957
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5gm9a_
  • Heterogens: CBK, CBI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gm9A (A:)
    asgsgqstrywdcckpscawpgkaavsqpvyacdanfqrlsdfnvqsgcnggsayscadq
    tpwavndnlaygfaatsiaggsesswccacyaltftsgpvagktmvvqststggdlgsnq
    fdiampgggvgifngcssqfgglpgaqyggissrdqcdsfpaplkpgcqwrfdwfqnadn
    ptftfqqvqcpaeivarsgckrnddssfpvftp