PDB entry 5gm7

View 5gm7 on RCSB PDB site
Description: Crystal structure of Ribosome inactivating protein from Momordica balsamina at 1.78 Angstrom resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 2016-07-13, released 2016-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome inactivating protein
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5gm7a_
  • Heterogens: NAG, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5gm7A (A:)
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni