PDB entry 5gm5

View 5gm5 on RCSB PDB site
Description: Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellobiose
Class: hydrolase/inhibitor
Keywords: substrate binding, HYDROLASE-INHIBITOR complex
Deposited on 2016-07-12, released 2017-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (Start-219)
      • engineered mutation (200)
    Domains in SCOPe 2.06: d5gm5a_
  • Chain 'B':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (Start-219)
      • engineered mutation (200)
    Domains in SCOPe 2.06: d5gm5b_
  • Chain 'C':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (Start-219)
      • engineered mutation (200)
    Domains in SCOPe 2.06: d5gm5c_
  • Chain 'D':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (Start-219)
      • engineered mutation (200)
    Domains in SCOPe 2.06: d5gm5d_
  • Chain 'E':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (0-219)
      • engineered mutation (200)
    Domains in SCOPe 2.06: d5gm5e_
  • Chain 'F':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (Start-219)
      • engineered mutation (200)
    Domains in SCOPe 2.06: d5gm5f_
  • Chain 'G':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (Start-219)
      • engineered mutation (200)
    Domains in SCOPe 2.06: d5gm5g_
  • Heterogens: CBI, SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gm5A (A:)
    qaqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvk
    syansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmi
    wlaryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyl
    tqnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm5A (A:)
    qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy
    ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl
    aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq
    nhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gm5B (B:)
    qaqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvk
    syansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmi
    wlaryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyl
    tqnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm5B (B:)
    aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
    yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
    laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
    qnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5gm5C (C:)
    qaqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvk
    syansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmi
    wlaryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyl
    tqnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm5C (C:)
    qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy
    ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl
    aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq
    nhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gm5D (D:)
    qaqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvk
    syansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmi
    wlaryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyl
    tqnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm5D (D:)
    qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy
    ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl
    aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq
    nhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gm5E (E:)
    qaqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvk
    syansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmi
    wlaryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyl
    tqnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5gm5F (F:)
    qaqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvk
    syansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmi
    wlaryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyl
    tqnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm5F (F:)
    qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy
    ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl
    aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq
    nhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5gm5G (G:)
    qaqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvk
    syansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmi
    wlaryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyl
    tqnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm5G (G:)
    aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
    yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
    laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
    qnhgfpassqylitlqfgtapftggpatlsvsnwsasvq