PDB entry 5gm4

View 5gm4 on RCSB PDB site
Description: Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose
Class: hydrolase/inhibitor
Keywords: substrate binding, HYDROLASE-INHIBITOR complex
Deposited on 2016-07-12, released 2017-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (0-218)
      • engineered mutation (199)
    Domains in SCOPe 2.06: d5gm4a_
  • Chain 'B':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (Start-218)
      • engineered mutation (199)
    Domains in SCOPe 2.06: d5gm4b_
  • Chain 'C':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (0-218)
      • engineered mutation (199)
    Domains in SCOPe 2.06: d5gm4c_
  • Chain 'D':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (Start-218)
      • engineered mutation (199)
    Domains in SCOPe 2.06: d5gm4d_
  • Chain 'E':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (0-218)
      • engineered mutation (199)
    Domains in SCOPe 2.06: d5gm4e_
  • Chain 'F':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (Start-218)
      • engineered mutation (199)
    Domains in SCOPe 2.06: d5gm4f_
  • Chain 'G':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22669 (Start-218)
      • engineered mutation (199)
    Domains in SCOPe 2.06: d5gm4g_
  • Heterogens: SO4, CTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gm4A (A:)
    aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
    yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
    laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
    qnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gm4B (B:)
    aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
    yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
    laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
    qnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm4B (B:)
    qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy
    ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl
    aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq
    nhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gm4C (C:)
    aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
    yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
    laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
    qnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5gm4D (D:)
    aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
    yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
    laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
    qnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm4D (D:)
    qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy
    ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl
    aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq
    nhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gm4E (E:)
    aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
    yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
    laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
    qnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5gm4F (F:)
    aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
    yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
    laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
    qnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm4F (F:)
    qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy
    ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl
    aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq
    nhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5gm4G (G:)
    aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
    yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
    laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
    qnhgfpassqylitlqfgtapftggpatlsvsnwsasvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm4G (G:)
    qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy
    ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl
    aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq
    nhgfpassqylitlqfgtapftggpatlsvsnwsasvq