PDB entry 5gm3

View 5gm3 on RCSB PDB site
Description: Crystal structure of FI-CMCase from Aspergillus aculeatus F-50
Class: hydrolase/inhibitor
Keywords: substrate binding, HYDROLASE-INHIBITOR complex
Deposited on 2016-07-12, released 2017-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gm3a_
  • Chain 'B':
    Compound: Endoglucanase-1
    Species: Aspergillus aculeatus [TaxId:5053]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5gm3b_
  • Heterogens: ZN, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5gm3A (A:)
    aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
    yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
    laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
    qnhgfpassqylitlqfgtepftggpatlsvsnwsasvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gm3B (B:)
    aqlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvks
    yansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiw
    laryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkylt
    qnhgfpassqylitlqfgtepftggpatlsvsnwsasvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm3B (B:)
    qlcdqyatytggvytinnnlwgkdagsgsqcttvnsassagtswstkwnwsggensvksy
    ansgltfnkklvsqisqipttarwsydntgiradvaydlftaadinhvtwsgdyelmiwl
    aryggvqpigsqiatatvdgqtwelwygangsqktysfvaptpitsfqgdvndffkyltq
    nhgfpassqylitlqfgtepftggpatlsvsnwsasvq