PDB entry 5gm1

View 5gm1 on RCSB PDB site
Description: crystal structure of methyltransferase tled complexed with sah
Deposited on 2016-07-12, released 2016-09-28
The last revision was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A077K7L1 (Start-288)
      • expression tag (289)
  • Chain 'D':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A077K7L1 (Start-288)
      • expression tag (289)
  • Chain 'L':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: O-methylransferase
    Species: Streptomyces blastmyceticus [TaxId:68180]
    Gene: tleD
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SAH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5gm1A (A:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1A (A:)
    qqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdy
    lietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglter
    ltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteel
    tepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrra
    efterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5gm1B (B:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1B (B:)
    qqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdyl
    ietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglterl
    tfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteelt
    epetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrrae
    fterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5gm1C (C:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1C (C:)
    qvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdyli
    etldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglterlt
    fevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteelte
    petalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrraef
    terfgaefvdgllaglgsaqetlirktrffmatlrkpavl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5gm1D (D:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1D (D:)
    qqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdyl
    ietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglterl
    tfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteelt
    epetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrrae
    fterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5gm1E (E:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1E (E:)
    qvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdyli
    etldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglterlt
    fevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteelte
    petalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrraef
    terfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5gm1F (F:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1F (F:)
    qqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdyl
    ietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglterl
    tfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteelt
    epetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrrae
    fterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5gm1G (G:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1G (G:)
    qqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdyl
    ietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglterl
    tfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteelt
    epetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrrae
    fterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5gm1H (H:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1H (H:)
    qvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdyli
    etldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglterlt
    fevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteelte
    petalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrraef
    terfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5gm1I (I:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1I (I:)
    qqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdyl
    ietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglterl
    tfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteelt
    epetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrrae
    fterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5gm1J (J:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1J (J:)
    qqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdy
    lietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglter
    ltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteel
    tepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrra
    efterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5gm1K (K:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1K (K:)
    qqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdyl
    ietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglterl
    tfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteelt
    epetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrrae
    fterfgaefvdgllaglgsaqetlirktrffmatlrkpavl
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5gm1L (L:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1L (L:)
    qqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdyl
    ietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglterl
    tfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteelt
    epetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrrae
    fterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >5gm1M (M:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1M (M:)
    qqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdy
    lietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglter
    ltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteel
    tepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrra
    efterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'N':
    Sequence, based on SEQRES records:
    >5gm1N (N:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1N (N:)
    qqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdy
    lietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglter
    ltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteel
    tepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrra
    efterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >5gm1O (O:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1O (O:)
    qqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdyl
    ietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglterl
    tfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteelt
    epetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrrae
    fterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >5gm1P (P:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1P (P:)
    qqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdyl
    ietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglterl
    tfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteelt
    epetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrrae
    fterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >5gm1Q (Q:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1Q (Q:)
    qqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdy
    lietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglter
    ltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteel
    tepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrra
    efterfgaefvdgllaglgsaqetlirktrffmatlrkpav
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >5gm1R (R:)
    mpqeartpqqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssq
    aqdrytdylietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrla
    aghglterltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvl
    esvvteeltepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfa
    lgvysrraefterfgaefvdgllaglgsaqetlirktrffmatlrkpavlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5gm1R (R:)
    qqqvtadevgdwydkfgevyhltlgesvhcglwfppdapvpqdmelvtmssqaqdrytdy
    lietldpkagqhlldigcgtgrtalkaarqrgiavtgvavskeqiaaanrlaaghglter
    ltfevadamrlpyedesfdcawaieslchmdrakalgeawrvlkpggdllvlesvvteel
    tepetalfetlyaanvpprlgeffdivsgagfhtlslkdlsanlamtmnvfalgvysrra
    efterfgaefvdgllaglgsaqetlirktrffmatlrkpav