PDB entry 5gm0

View 5gm0 on RCSB PDB site
Description: Tl-gal with lactose
Class: sugar binding protein
Keywords: Carbohydrates, Toxascaris leonina, Galectin, SUGAR BINDING PROTEIN
Deposited on 2016-07-12, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Toxascaris leonina [TaxId:59264]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GM0 (Start-283)
    Domains in SCOPe 2.07: d5gm0a1, d5gm0a2, d5gm0a3
  • Chain 'B':
    Compound: galectin
    Species: Toxascaris leonina [TaxId:59264]
    Database cross-references and differences (RAF-indexed):
    • PDB 5GM0 (Start-283)
    Domains in SCOPe 2.07: d5gm0b1, d5gm0b2, d5gm0b3
  • Heterogens: GAL, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5gm0A (A:)
    hhhhhhmatetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndv
    plhisvrfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevk
    eyehrvplssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekk
    gkrfhinllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefr
    neeyafqiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm0A (A:)
    matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
    rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
    plssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekkgkrfhi
    nllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefrneeyaf
    qiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5gm0B (B:)
    hhhhhhmatetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndv
    plhisvrfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevk
    eyehrvplssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekk
    gkrfhinllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefr
    neeyafqiyvdgerfatyahrldphdinglqiggdvevtgiqmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5gm0B (B:)
    matetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisv
    rfdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrv
    plssvthfsvdgdilityihwggkyypvpyesglagdglapgksllifatpekkgkrfhi
    nllkkngdialhfnprfdekaivrnslisgewgneeregknplekgigcdlefrneeyaf
    qiyvdgerfatyahrldphdinglqiggdvevtgiqmv